Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human E3 Ubiquitin-Protein Ligase CHIP/CHIP

Source: E.coli. MW :34.86kD. Recombinant Human STUB1 is produced by our E.coli expression system and the target gene encoding Met1-Tyr303 is expressed. E3 Ubiquitin-Protein Ligase CHIP is a cytoplasmic protein. CHIP is highly expressed in skeletal muscle, heart, pancreas, brain and placenta. CHIP interacts with the molecular chaperones Hsc70-Hsp70 and Hsp90 through its TPR domain; lead to in client substrate ubiquitylation and degradation by the proteasome. CHIP targets misfolded chaperone substrates towards proteasomal degradation. CHIP mediates transfer of non-canonical short ubiquitin chains to HSPA8 that have no effect on HSPA8 degradation. CHIP plays a role in base-excision repair: catalyzes polyubiquitination by amplifying the HUWE1/ARF-BP1-dependent monoubiquitination and leading to POLB-degradation by the proteasome. It also may regulate the receptor stability and activity through proteasomal degradation.

Product Specifications

Gene Name

STUB1

Gene ID

10273

UniProt

Q9UNE7

Components

Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELHSYLSRLIAAERERELEECQRNHEGDEDDSHVRAQQACIEAKHDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

DNA-Directed RNA Polymerase III Subunit RPC1 (RPC1) Antibody
abx249450-01 10 µg

DNA-Directed RNA Polymerase III Subunit RPC1 (RPC1) Antibody

Ask
View Details
DNA-Directed RNA Polymerase III Subunit RPC1 (RPC1) Antibody
abx249450-02 100 µg

DNA-Directed RNA Polymerase III Subunit RPC1 (RPC1) Antibody

Ask
View Details
DNA-Directed RNA Polymerase III Subunit RPC1 (RPC1) Antibody
abx249450-03 200 µg

DNA-Directed RNA Polymerase III Subunit RPC1 (RPC1) Antibody

Ask
View Details
DNA-Directed RNA Polymerase III Subunit RPC1 (RPC1) Antibody
abx249450-04 300 µg

DNA-Directed RNA Polymerase III Subunit RPC1 (RPC1) Antibody

Ask
View Details
DNA-Directed RNA Polymerase III Subunit RPC1 (RPC1) Antibody
abx249450-05 1 mg

DNA-Directed RNA Polymerase III Subunit RPC1 (RPC1) Antibody

Ask
View Details
ID3 Polyclonal Antibody, Cy5 Conjugated
bs-6229R-Cy5 100 µL

ID3 Polyclonal Antibody, Cy5 Conjugated

Ask
View Details