Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-C Motif Chemokine 26/CCL26 (27-94)

Source: E.coli. MW :8.21kD. Recombinant Human C-C Motif Chemokine 26 is produced by our E.coli expression system and the target gene encoding Ser27-Leu94 is expressed. Chemokine (C C Motif) Ligand 26 (CCL26) is a novel small cytokine belonging to the CC chemokine family, which involved in immunoregulatory and inflammatory processes. CCL26 is expressed constitutively in thymus, but only transiently in phytohemagglutinin-stimulated peripheral blood mononuclear cells. It specifically binds and induces chemotaxis in T cells and elicits its effects by interacting with the chemokine receptor CCR4. Eotaxin-3/CCL26, along with Eotaxin-1 and Eotaxin-2, selectively activates the CC chemokine receptor 3 (CCR3) . The Eotaxin-3-CCR3 interaction may play an important role in allergic diseases such as atopic dermatitis and bronchial asthma. The full-length cDNA for Eotaxin-3 encodes a protein of 94 amino acids with a putative signal peptide of either 23 or 26 amino acid residues. Both the 71 and 68 amino acid residue variants of recombinant Eotaxin-3 demonstrate equal potency in inducing chemotaxis of a human CCR3-transfected cell line. Unlike most other CC chemokines, Eotaxin-3 maps to human chromosome 7q11.2, within 40 kilobases of the Eotaxin-2 loci. Eotaxin-3 and Eotaxin-2 are unique in that they are the only chemokines identified to date that map to chromosome 7.

Product Specifications

Gene Name

CCL26

Gene ID

10344

UniProt

Q9Y258

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal AKR7A3 Antibody
NBP1-31614 100 µL

Rabbit Polyclonal AKR7A3 Antibody

Sign In for Pricing
View Details
Human GZMA (Granzyme A) ELISA Kit
EK244102 96 Well

Human GZMA (Granzyme A) ELISA Kit

Sign In for Pricing
View Details
ROBO1 ORF Vector (Human) (pORF)
40671011 1.0 µg DNA

ROBO1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Recombinant Mouse CXCL16
7-01806 1 mg

Recombinant Mouse CXCL16

Sign In for Pricing
View Details
HNRNPR Polyclonal Antibody
MBS9128321-01 0.02 mL

HNRNPR Polyclonal Antibody

Sign In for Pricing
View Details
HNRNPR Polyclonal Antibody
MBS9128321-02 0.1 mL

HNRNPR Polyclonal Antibody

Sign In for Pricing
View Details