Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-C Motif Chemokine 26/CCL26 (24-94)

Source: E.coli. MW :8.53kD. Recombinant Human C-C Motif Chemokine 26 is produced by our E.coli expression system and the target gene encoding Thr24-Leu94 is expressed. Chemokine Ligand 26 protein (CCL26) is a novel small cytokine belonging to the CC chemokine family which is involved in immunoregulatory and inflammatory processes. CCL26 is constitutively expressed in thymus, but only transiently expressed in phytohemagglutinin-stimulated peripheral blood mononuclear cells. It specifically binds and induces chemotaxis in T cells and elicits its effects by interacting with the chemokine receptor CCR4. CCL26, along with Eotaxin-1 and Eotaxin-2, selectively activates the CC chemokine receptor 3 (CCR3) . The Eotaxin-3-CCR3 interaction may play an important role in allergic diseases such as atopic dermatitis and bronchial asthma. The full-length cDNA for CCL26 encodes a protein of 94 amino acids with a putative signal peptide of either 23 or 26 amino acid residues. Both the 71 and 68 amino acid residue variants of recombinant CCL26 demonstrate equal potency in inducing chemotaxis of a human CCR3-transfected cell line. Unlike most other CC chemokines, CCL26 maps to human chromosome 7q11.2, within 40 kilobases of the Eotaxin-2 loci. CCL26 and Eotaxin-2 are unique in that they are the only chemokines identified to date that map to chromosome 7.

Product Specifications

Gene Name

CCL26

Gene ID

10344

UniProt

Q9Y258

Components

Supplied as a 0.2 μm filtered solution of 20mM Tris, 1mM EDTA, 20% Glycerol, pH 9.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MTRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL

More Discoveries

Explore Other Products

Browse additional items from our catalog

METTL2B (NM_018396) Human Tagged ORF Clone Lentiviral Particle
RC219439L1V 200 µL

METTL2B (NM_018396) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
JAK2 Inhibitor V
MF-0094855-01 2 mg

JAK2 Inhibitor V

Sign In for Pricing
View Details
JAK2 Inhibitor V
MF-0094855-02 5 mg

JAK2 Inhibitor V

Sign In for Pricing
View Details
JAK2 Inhibitor V
MF-0094855-03 1 mL - 10 mM (in DMSO)

JAK2 Inhibitor V

Sign In for Pricing
View Details
JAK2 Inhibitor V
MF-0094855-04 10 mg

JAK2 Inhibitor V

Sign In for Pricing
View Details
JAK2 Inhibitor V
MF-0094855-05 25 mg

JAK2 Inhibitor V

Sign In for Pricing
View Details