Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Carbonic Anhydrase 8/CA8 (C-6His)

Source: E.coli. MW :34.04kD. Recombinant Human Carbonic Anhydrase 8 is produced by our E.coli expression system and the target gene encoding Ala2-Gln290 is expressed with a 6His tag at the C-terminus. Carbonic Anhydrase 8 (CA8) belongs to the alpha-carbonic anhydrase family. Alpha-carbonic anhydrase is a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. Because CA8 has some sequence similarity with other known carbonic anhydrase genes, it was firstly called as CA-related protein. Nevertheless, CA8 does not have a carbonic anhydrase catalytic activity. Defects in CA8 are the cause of cerebellar ataxia mental retardation and dysequilibrium syndrome type 3 (CMARQ3), which is a congenital cerebellar ataxia associated with dysarthia, quadrupedal gait and mild mental retardation.

Product Specifications

Gene Name

CA8

Gene ID

767

UniProt

P35219

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 500mM NaCl, 1mM DTT, pH 8.5 .

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test. Biological Activity : Specific Activity is greater than 56.08pmol/min/ug

Amino Acids

ADLSFIEDTVAFPEKEEDEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVRFHWGRENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLKAVTEILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQLEHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human Zika Virus IgG (ZIKV-IgG) ELISA Kit
abx050301 96 Tests

Human Zika Virus IgG (ZIKV-IgG) ELISA Kit

Ask
View Details
CD30-L rabbit pAb
ES5686-01 50 µL

CD30-L rabbit pAb

Ask
View Details
CD30-L rabbit pAb
ES5686-02 100 µL

CD30-L rabbit pAb

Ask
View Details
Monoclonal Antibody to CD68 (Macrophage Marker) (Clone : KP1)
36-1965-100 100 µg

Monoclonal Antibody to CD68 (Macrophage Marker) (Clone : KP1)

Ask
View Details
NLGN4Y, NT (NLGN4Y, KIAA0951, Neuroligin-4, Y-linked) (PE)
MBS6325707-01 0.2 mL

NLGN4Y, NT (NLGN4Y, KIAA0951, Neuroligin-4, Y-linked) (PE)

Ask
View Details
NLGN4Y, NT (NLGN4Y, KIAA0951, Neuroligin-4, Y-linked) (PE)
MBS6325707-02 5x 0.2 mL

NLGN4Y, NT (NLGN4Y, KIAA0951, Neuroligin-4, Y-linked) (PE)

Ask
View Details