Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Carbonic Anhydrase 8/CA8 (C-6His)

Source: E.coli. MW :34.04kD. Recombinant Human Carbonic Anhydrase 8 is produced by our E.coli expression system and the target gene encoding Ala2-Gln290 is expressed with a 6His tag at the C-terminus. Carbonic Anhydrase 8 (CA8) belongs to the alpha-carbonic anhydrase family. Alpha-carbonic anhydrase is a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. Because CA8 has some sequence similarity with other known carbonic anhydrase genes, it was firstly called as CA-related protein. Nevertheless, CA8 does not have a carbonic anhydrase catalytic activity. Defects in CA8 are the cause of cerebellar ataxia mental retardation and dysequilibrium syndrome type 3 (CMARQ3), which is a congenital cerebellar ataxia associated with dysarthia, quadrupedal gait and mild mental retardation.

Product Specifications

Gene Name

CA8

Gene ID

767

UniProt

P35219

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 500mM NaCl, 1mM DTT, pH 8.5 .

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test. Biological Activity : Specific Activity is greater than 56.08pmol/min/ug

Amino Acids

ADLSFIEDTVAFPEKEEDEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVRFHWGRENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLKAVTEILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQLEHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp54 Mouse qPCR Primer Pair (NM_011760)
MP218899 200 Reactions

Zfp54 Mouse qPCR Primer Pair (NM_011760)

Sign In for Pricing
View Details
Rsk-3 Double Nickase Plasmid (m2)
sc-422750-NIC-2 20 µg

Rsk-3 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
FAM27E1 siRNA Oligos set (Human)
19995171 3x 5 nmol

FAM27E1 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Semaphorin 5A (S106) (Semaphorin-F, Sema F, Semaphorin-5A, SEMAF, SEMA5A) (Biotin) discontinued
S0668-57D-Biotin 200 µL

Semaphorin 5A (S106) (Semaphorin-F, Sema F, Semaphorin-5A, SEMAF, SEMA5A) (Biotin) discontinued

Sign In for Pricing
View Details
2- (4-bromophenyl) thiazolo[4,5-d]pyrimidine
JH920229 1 Each

2- (4-bromophenyl) thiazolo[4,5-d]pyrimidine

Sign In for Pricing
View Details
Recombinant Syntrophobacter fumaroxidans NADH-quinone oxidoreductase subunit A (nuoA)
MBS7023843-01 0.02 mg

Recombinant Syntrophobacter fumaroxidans NADH-quinone oxidoreductase subunit A (nuoA)

Sign In for Pricing
View Details