Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Carbonic Anhydrase 5B/CA5B (C-6His)

Source: E.coli. MW :33.77kD. Recombinant Human Carbonic Anhydrase 5B is produced by our E.coli expression system and the target gene encoding Cys34-Pro317 is expressed with a 6His tag at the C-terminus. Carbonic Anhydrase 5B (CA5B) is a member of alpha-carbonic anhydrase family (CAs) that catalyze the reversible hydration of carbon dioxide. CAs is associated with many biological processes, including calcification, respiration, bone resorption, acid-base balance and the formation of aqueous humor. CA5B is highly expressed in heart, pancreas, kidney, placenta, lung, and skeletal muscle, but it is restricted to the liver. CA5B is localized in the mitochondria and shows the highest sequence similarity to the other mitochondrial CA, CA-VA. CA5B is inhibited by coumarins, sulfonamide derivatives such as acetazolamide (AZA), saccharin, and Foscarnet.

Product Specifications

Gene Name

CA5B

Gene ID

11238

UniProt

Q9Y2D0

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test. Biological Activity : Specific Activity is greater than 2665.15pmol/min/ug

Amino Acids

MCSLYTCTYKTRNRALHPLWESVDLVPGGDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPLEHNYRLKQFHFHWGAIDAWGSEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDYVLNVQAKPKPATSQATPLEHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

FTL (Ferritin, Light Polypeptide, MGC71996) (MaxLight 750)
MBS6238350-01 0.1 mL

FTL (Ferritin, Light Polypeptide, MGC71996) (MaxLight 750)

Ask
View Details
FTL (Ferritin, Light Polypeptide, MGC71996) (MaxLight 750)
MBS6238350-02 5x 0.1 mL

FTL (Ferritin, Light Polypeptide, MGC71996) (MaxLight 750)

Ask
View Details
Human EIF5B activation kit by CRISPRa
GA106483 1 Kit

Human EIF5B activation kit by CRISPRa

Ask
View Details
Human hsa-miR-1179 miRNA Antagomir
abx885981-01 10 nmol

Human hsa-miR-1179 miRNA Antagomir

Ask
View Details
Human hsa-miR-1179 miRNA Antagomir
abx885981-02 20 nmol

Human hsa-miR-1179 miRNA Antagomir

Ask
View Details
N, N, N', N'', N''-Pentamethyldiethylenetriamine discontinued
285477-01 25 g

N, N, N', N'', N''-Pentamethyldiethylenetriamine discontinued

Ask
View Details