Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Bcl-2 Related Protein A1/BCL2A1 (C-6His)

Source: E.coli. MW :18.52kD. Recombinant Human Bcl-2 Related Protein A1 is produced by our E.coli expression system and the target gene encoding Met1-Ser152 is expressed with a 6His tag at the C-terminus. Bcl-2-Related Protein A1 (BCL2A1) is a member of of the BCL-2 protein family which act as anti- and pro-apoptotic regulators that are involved in a wide variety of cellular activities such as embryonic development, homeostasis and tumorigenesis. BCL2A1 is a cytoplasm protein and interacts directly with BAK1, BID, BMF and BBC3. BCL2A1 is induced by phorbol ester and inflammatory cytokines, such as TNF or IL1B/interleukin-1 beta, but not by growth factors. BCL2A1 is invovled in the response of hemopoietic cells to external signals and in maintaining endothelial survival during infection.

Product Specifications

Gene Name

BCL2A1

Gene ID

597

UniProt

Q16548

Components

Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 1mM EDTA, 1mM DTT, 10% Glycerol, pH 7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSLEHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Integrin alpha 6 (ITGA6) Human Gene Knockout Kit (CRISPR)
KN421990 1 Kit

Integrin alpha 6 (ITGA6) Human Gene Knockout Kit (CRISPR)

Ask
View Details
Pdzd4 Rat shRNA Plasmid (Locus ID 293856)
TR709009 1 Kit

Pdzd4 Rat shRNA Plasmid (Locus ID 293856)

Ask
View Details
Macrophage Stimulating Protein (Macrophage Stimulatory Protein, MSP, MST1, D3F15S2, DNF15S2, Hepatocyte Growth Factor-like Protein, HGFL, NF15S2) (FITC)
129286-FITC 100 µL

Macrophage Stimulating Protein (Macrophage Stimulatory Protein, MSP, MST1, D3F15S2, DNF15S2, Hepatocyte Growth Factor-like Protein, HGFL, NF15S2) (FITC)

Ask
View Details
Human Orexin A (OX-A) Elisa Kit
EK711254 96 Well

Human Orexin A (OX-A) Elisa Kit

Ask
View Details
Recombinant Mouse Mitochondrial import receptor subunit TOM5 homolog (Tomm5) , partial
MBS1046335-01 1 mg (E-Coli)

Recombinant Mouse Mitochondrial import receptor subunit TOM5 homolog (Tomm5) , partial

Ask
View Details
Recombinant Mouse Mitochondrial import receptor subunit TOM5 homolog (Tomm5) , partial
MBS1046335-02 1 mg (Yeast)

Recombinant Mouse Mitochondrial import receptor subunit TOM5 homolog (Tomm5) , partial

Ask
View Details