Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human beta-Arrestin 1/ARRB1 (C-6His)

Source: E.coli. MW :48.13kD. Recombinant Human beta-Arrestin 1 is produced by our E.coli expression system and the target gene encoding Met1-Arg418 is expressed with a 6His tag at the C-terminus. beta-Arrestin-1 (ARRB1) is a cytoplasmic protein that belongs to the arrestin family. ARRB1 is expressed at high levels in peripheral blood leukocytes and the central nervous system. ARRB1 regulates agonist-mediated G-protein coupled receptor (GPCR) signaling by mediating both receptor desensitization and resensitization processes. ARRB1 acts as a cofactor in the beta-adrenergic receptor kinase (BARK) mediated desensitization of beta-adrenergic receptors. ARRB1 is believed to play a major role in regulating receptor-mediated immune functions. ARRB1 is involved in Toll-like receptor and IL-1 receptor signaling through the interaction with TRAF6.

Product Specifications

Gene Name

ARRB1

Gene ID

408

UniProt

P49407

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPPHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNNRLEHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

3-Amino-4-chloropyridine (4-Chloro-pyridin-3-ylamine, 4-Chloro-3-pyridinamine)
MBS6037025-01 1 g

3-Amino-4-chloropyridine (4-Chloro-pyridin-3-ylamine, 4-Chloro-3-pyridinamine)

Ask
View Details
3-Amino-4-chloropyridine (4-Chloro-pyridin-3-ylamine, 4-Chloro-3-pyridinamine)
MBS6037025-02 5x 1 g

3-Amino-4-chloropyridine (4-Chloro-pyridin-3-ylamine, 4-Chloro-3-pyridinamine)

Ask
View Details
Mouse Copg1 Pre-designed siRNA Set A
SI102935A 1 Each

Mouse Copg1 Pre-designed siRNA Set A

Ask
View Details
CLEC18A (NM_182619) Human Tagged Lenti ORF Clone
RC209903L4 10 µg

CLEC18A (NM_182619) Human Tagged Lenti ORF Clone

Ask
View Details
Anti-HSP27 Monoclonal Antibody (Clone : 8A7) - ATTO 390
42-1182-100 100 µg

Anti-HSP27 Monoclonal Antibody (Clone : 8A7) - ATTO 390

Ask
View Details
AR-AO 14418
TRC-A765500-5MG 5 mg

AR-AO 14418

Ask
View Details