Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Apurinic-Apyrimidinic Endonuclease 1/APE

Source: E.coli. MW :35.62kD. Recombinant Human Apurinic-Apyrimidinic Endonuclease 1 is produced by our E.coli expression system and the target gene encoding Pro2-Leu318 is expressed. Apurinic-Apyrimidinic Endonuclease 1 (APE1) is required for efficient DNA base excision repair. When the DNA glycosylase remove the damaged bases, APE1 cleaves the AP site to allow resynthesis and ligation to complete repair. APE1 stimulates the DNA binding activity of many transcription factors, which participate in cancer promotion and progression. APE1 regulates the redox state of multiple transcription factors, such as c-Jun, c-Fos, NF-kB, p53. APEN is also involved in calcium-dependent down-regulation of PTH expression.

Product Specifications

Gene Name

APEX1

Gene ID

328

UniProt

P27695

Components

Supplied as a 0.2 μm filtered solution of 10mM HEPES, 100mM KCl, 50% Glycerol, pH 7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGEEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Copper Assay Kit
abx298883 96 Tests

Copper Assay Kit

Ask
View Details
TAAL6 Polyclonal Antibody, HRP Conjugated
bs-6242R-HRP 100 µL

TAAL6 Polyclonal Antibody, HRP Conjugated

Ask
View Details
PIAS2, CT (E3 SUMO-protein Ligase PIAS2, Protein Inhibitor of Activated STAT2, Protein Inhibitor of Activated STAT x, Msx-interacting Zinc Finger Protein, Miz1, DAB2-interacting Protein, DIP, Androgen Receptor-interacting Protein 3, ARIP3, PIAS-NY Protein, PIASX) (Biotin) discontinued
P4085-11B-Biotin 200 µL

PIAS2, CT (E3 SUMO-protein Ligase PIAS2, Protein Inhibitor of Activated STAT2, Protein Inhibitor of Activated STAT x, Msx-interacting Zinc Finger Protein, Miz1, DAB2-interacting Protein, DIP, Androgen Receptor-interacting Protein 3, ARIP3, PIAS-NY Protein, PIASX) (Biotin) discontinued

Ask
View Details
Rabbit Monoclonal PMS2 Antibody (PMS2/8224R) [Janelia Fluor 646]
NBP3-24032JF646 0.1 mL

Rabbit Monoclonal PMS2 Antibody (PMS2/8224R) [Janelia Fluor 646]

Ask
View Details
Rabbit Monoclonal CD8 beta Antibody (039)
NBP2-89751-100ul 100 µL

Rabbit Monoclonal CD8 beta Antibody (039)

Ask
View Details
14-3-3 sigma/YWHAS Protein (N-GST, Human)
P512915 100 µg

14-3-3 sigma/YWHAS Protein (N-GST, Human)

Ask
View Details