Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sonic Hedgehog/SHH

Source: E.coli. MW :19.69kD. Recombinant Human Sonic Hedgehog is produced by our E.coli expression system and the target gene encoding Cys24-Gly197 is expressed. Sonic Hedgehog Homolog (SHH) belongs to a three-protein family called hedgehog. The other two family members are Indian Hedgehog (IHH) and Desert Hedgehog (DHH) . Hedgehog proteins are key signaling molecules in embryonic development. SHH is expressed in various embryonic tissues and plays critical roles in regulating the patterning of many systems, such as limbs and brain. SHH also plays an important role in adult, including the division of adult stem cells and the development of certain cancers and other diseases. Human SHH is expressed as a 45kDa precursor, and undergoes a series of processing during secretion. After the removal of the signal peptide, a protease within the C-terminal domain catalyzes the cleavage of SHH into a 20 kDa N-terminal signaling domain (SHH-N) and a 25 kDa C-terminal domain (SHH-C) . SHH-N has the “all signaling” capability. SHH-N binds to the 12 pass transmembrane protein Patched (Ptc) on cell surface, which releases the repression of the activity of Smoothened (Smo), a G-protein coupled receptor, by Ptc.

Product Specifications

Gene Name

SHH

Gene ID

6469

UniProt

Q15465

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 100mM NaCl, 1mM DTT, pH 7.5.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MCGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Atoh8 (NM_153778) Mouse Tagged ORF Clone Lentiviral Particle
MR204653L3V 200 µL

Atoh8 (NM_153778) Mouse Tagged ORF Clone Lentiviral Particle

Ask
View Details
C-C Chemokine Receptor Type 2 (CCR2) Antibody (FITC)
abx448110 100 µg

C-C Chemokine Receptor Type 2 (CCR2) Antibody (FITC)

Ask
View Details
Endothelin A Receptor (EDNRA, Endothelin Receptor SubType A, Et-a-r, ETRA, Endothelin A Receptor, Endothelin eta Receptor, Endothelin Type a Receptor, Endothelin-1 Receptor, ETAR, Endothelin Receptor Type A, HET-AR, Et-a Receptor, ETA, ETA-R, Endothelin Receptor: SubType a, Endothelin-1-specific Receptor, ET-A, ET-RA)
170439 50 µg

Endothelin A Receptor (EDNRA, Endothelin Receptor SubType A, Et-a-r, ETRA, Endothelin A Receptor, Endothelin eta Receptor, Endothelin Type a Receptor, Endothelin-1 Receptor, ETAR, Endothelin Receptor Type A, HET-AR, Et-a Receptor, ETA, ETA-R, Endothelin Receptor: SubType a, Endothelin-1-specific Receptor, ET-A, ET-RA)

Ask
View Details
Human Anti-Phospholipase A2 Receptor Antibody, (Anti-PLA2R1 AB) ELISA Kit
YLA3793HU-01 48 Tests

Human Anti-Phospholipase A2 Receptor Antibody, (Anti-PLA2R1 AB) ELISA Kit

Ask
View Details
Human Anti-Phospholipase A2 Receptor Antibody, (Anti-PLA2R1 AB) ELISA Kit
YLA3793HU-02 96 Tests

Human Anti-Phospholipase A2 Receptor Antibody, (Anti-PLA2R1 AB) ELISA Kit

Ask
View Details
SND1 Polyclonal Antibody
E55A01312 100 µg

SND1 Polyclonal Antibody

Ask
View Details