Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ciliary Neurotrophic Factor/CNTF

Source: E.coli. MW :22.93kD. Recombinant Human CNTF is produced by our E.coli expression system and the target gene encoding Ala2-Met200 is expressed. Ciliary Neurotrophic Factor (CNTF) is a potent survival factor for neurons and oligodendrocytes. CNTF has also been shown to prevent the degeneration of motor axons after axotomy. CNTF is highly conserved across species and exhibits cross-species activities. Human and rat CNTF share approximately 83% homology in their protein sequence. CNTF is structurally related to IL6, IL11, LIF and OSM. All of these four helix bundle cytokines share gp130 as a signal transducing subunit in their receptor complexes. CNTF, like FGF acidic, FGF basic, and PD-ECGF (platelet-derived endothelial cell growth factor), does not possess a signal sequence that would allow secretion of the factor by classical secretion pathways. The mechanism underlying the release of CNTF is unknown.

Product Specifications

Gene Name

CNTF

Gene ID

1270

UniProt

P26441

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 1mM Cysteine, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

AFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBX22 Antibody
MBS8581945-01 0.1 mL

TBX22 Antibody

Sign In for Pricing
View Details
TBX22 Antibody
MBS8581945-02 0.1 mL (AF635)

TBX22 Antibody

Sign In for Pricing
View Details
TBX22 Antibody
MBS8581945-03 0.1 mL (AF610)

TBX22 Antibody

Sign In for Pricing
View Details
TBX22 Antibody
MBS8581945-04 0.1 mL (AF405S)

TBX22 Antibody

Sign In for Pricing
View Details
TBX22 Antibody
MBS8581945-05 0.1 mL (AF405L)

TBX22 Antibody

Sign In for Pricing
View Details
TBX22 Antibody
MBS8581945-06 0.1 mL (AF546)

TBX22 Antibody

Sign In for Pricing
View Details