Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-33/IL-33

Source: E.coli. MW :20.29kD. Recombinant Human Interleukin-33 is produced by our E.coli expression system and the target gene encoding Ser112-Thr270 is expressed. Interleukin-33 (IL-33) was initially discovered as a nuclear factor NF-HEV abundantly expressed in high endothelial venules. It is a 30-32 kD pro-inflammatory protein with intracellular and extracellular activities and a chromatin-associated cytokine of the IL-1 family with high sequence and structural similarity to IL-1 and IL-18. IL-33 is highly and selectively expressed by high endothelial venule endothelial cells (HEVECs) in human tonsils, Peyers's patches, and lymph nodes. It contains a bipartite nuclear localization signal at the C-terminus, and is targeted to the nucleus when ectopically expressed in human umbilical vein endothelial cells (HUVECs) and HeLa cells. The C-terminal fragment, corresponding to mature IL-33, binds and triggers signaling. IL-33 mediates its biological effects via Toll-interleukin 1 (IL-1) receptor (TIR) domain-containing receptor ST2, activates NF-kappaB and MAP kinases, and drives production of T (H) 2-associated cytokines from in vitro polarized T (H) 2 cells. In vivo, IL-33 induces the expression of IL-4, IL-5, and IL-13 and leads to severe pathological changes in mucosal organs. Human IL-33 is 270 amino acids in length.

Product Specifications

Gene Name

IL33

Gene ID

90865

UniProt

O95760

Components

Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 7.5.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human KCNK6 Knockout HEK293T cell line
GTR15403117 1 Vial

Human KCNK6 Knockout HEK293T cell line

Ask
View Details
MDH1 (NM_001199112) Human Tagged ORF Clone Lentiviral Particle
RC230787L3V 200 µL

MDH1 (NM_001199112) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
pExpress-1-Gstt4 Plasmid
PVT39281 2 µg

pExpress-1-Gstt4 Plasmid

Ask
View Details
Mouse Olfactory receptor 15 (OLFR15) ELISA Kit
abx536807 96 Tests

Mouse Olfactory receptor 15 (OLFR15) ELISA Kit

Ask
View Details
TRNAS20 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
48376061 1.0 µg DNA

TRNAS20 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Ask
View Details