Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-33/IL-33

Source: E.coli. MW :20.29kD. Recombinant Human Interleukin-33 is produced by our E.coli expression system and the target gene encoding Ser112-Thr270 is expressed. Interleukin-33 (IL-33) was initially discovered as a nuclear factor NF-HEV abundantly expressed in high endothelial venules. It is a 30-32 kD pro-inflammatory protein with intracellular and extracellular activities and a chromatin-associated cytokine of the IL-1 family with high sequence and structural similarity to IL-1 and IL-18. IL-33 is highly and selectively expressed by high endothelial venule endothelial cells (HEVECs) in human tonsils, Peyers's patches, and lymph nodes. It contains a bipartite nuclear localization signal at the C-terminus, and is targeted to the nucleus when ectopically expressed in human umbilical vein endothelial cells (HUVECs) and HeLa cells. The C-terminal fragment, corresponding to mature IL-33, binds and triggers signaling. IL-33 mediates its biological effects via Toll-interleukin 1 (IL-1) receptor (TIR) domain-containing receptor ST2, activates NF-kappaB and MAP kinases, and drives production of T (H) 2-associated cytokines from in vitro polarized T (H) 2 cells. In vivo, IL-33 induces the expression of IL-4, IL-5, and IL-13 and leads to severe pathological changes in mucosal organs. Human IL-33 is 270 amino acids in length.

Product Specifications

Gene Name

IL33

Gene ID

90865

UniProt

O95760

Components

Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 7.5.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Kylt® GPS
31372 100 Reactions

Kylt® GPS

Ask
View Details
Recombinant Acinetobacter sp. Elongation factor Ts (tsf)
MBS1472251-01 0.02 mg (E-Coli)

Recombinant Acinetobacter sp. Elongation factor Ts (tsf)

Ask
View Details
Recombinant Acinetobacter sp. Elongation factor Ts (tsf)
MBS1472251-02 0.02 mg (Yeast)

Recombinant Acinetobacter sp. Elongation factor Ts (tsf)

Ask
View Details
Recombinant Acinetobacter sp. Elongation factor Ts (tsf)
MBS1472251-03 0.1 mg (E-Coli)

Recombinant Acinetobacter sp. Elongation factor Ts (tsf)

Ask
View Details
Recombinant Acinetobacter sp. Elongation factor Ts (tsf)
MBS1472251-04 0.1 mg (Yeast)

Recombinant Acinetobacter sp. Elongation factor Ts (tsf)

Ask
View Details
Recombinant Acinetobacter sp. Elongation factor Ts (tsf)
MBS1472251-05 0.02 mg (Baculovirus)

Recombinant Acinetobacter sp. Elongation factor Ts (tsf)

Ask
View Details