Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-13/IL-13 (Pro22-Phe131)

Source: E.coli. MW :12.2kD. Recombinant Mouse Interleukin-13 is produced by our E.coli expression system and the target gene encoding Pro22-Phe131 is expressed. Mouse interleukin 13 (mIL-13) is a pleiotropic cytokine produced by activated Th2 cells. IL-13 induces B cell proliferation and immunoglobin production. It contains a four helical bundle with two internal disulfide bonds. Mouse IL13 shares 58% sequence identity with human protein and exhibits cross-species activity. IL13 signals via receptor IL13R (type2, IL4R) and activates STAT-6. IL13 initially binds IL-13Ra1 with low affinity and triggers association of IL4Ra, generating a high affinity heterodimeric receptor IL13R and eliciting downstream signals. IL13 also binds IL-13Ra2 with high affinity, which plays a role in a negative feedback system of IL13 signaling. IL13 is an important mediator of allergic inflammation and disease.

Product Specifications

Gene Name

Il13

Gene ID

16163

UniProt

P20109

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MPVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

pX552 Plasmid
PVT6311 2 µg

pX552 Plasmid

Ask
View Details
Mouse Monoclonal RHOBTB2 Antibody (DBC2/3364) [Alexa Fluor 488]
NBP3-08806AF488 100 µL

Mouse Monoclonal RHOBTB2 Antibody (DBC2/3364) [Alexa Fluor 488]

Ask
View Details
SIRT5 Knockout MAC-T Cell Line
ARG0521 1 Million

SIRT5 Knockout MAC-T Cell Line

Ask
View Details
MC2-R Polyclonal Antibody
MBS8523655-01 0.1 mg

MC2-R Polyclonal Antibody

Ask
View Details
MC2-R Polyclonal Antibody
MBS8523655-02 0.1 mL (AF635)

MC2-R Polyclonal Antibody

Ask
View Details
MC2-R Polyclonal Antibody
MBS8523655-03 0.1 mL (AF610)

MC2-R Polyclonal Antibody

Ask
View Details