Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cystatin A (N-6His)

Source: E.coli. MW :11.8kD. Recombinant Human Cystatin A is produced by our E.coli expression system and the target gene encoding Ile2-Phe98 is expressed with a 6His tag at the N-terminus. Human Cystatin A (CSTA) is a member of family 1 of the cystatin superfamily, which is characterized by lacking of disulphide bonds an carbohydrates. Cystatin A is an intracellular inhibitor regulating the activities of cysteine proteases of the papain family such as Cathepsins B, H and L. Cystatin A is also implicated in a number of disease states. Due to altered proteolytic state in cancer progression, Cystatin A may play a role in the proteolytic pathways.

Product Specifications

Gene Name

CSTA

Gene ID

1475

UniProt

P01040

Components

Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, pH 8.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MHHHHHHIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

2,3-Dihydroxybenzaldehyde
TRC-D451010-1G 1 g

2,3-Dihydroxybenzaldehyde

Ask
View Details
PRCD (NM_001077620) Human Tagged ORF Clone Lentiviral Particle
RC216764L4V 200 µL

PRCD (NM_001077620) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
Mouse Poly [ADP-ribose] polymerase 16 (PARP16) ELISA Kit
abx537792 96 Tests

Mouse Poly [ADP-ribose] polymerase 16 (PARP16) ELISA Kit

Ask
View Details
TXNL6 (NXNL1) Rabbit Polyclonal Antibody
TA370329 100 µL

TXNL6 (NXNL1) Rabbit Polyclonal Antibody

Ask
View Details
DLAT Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-62155R-BF594-01 20 µL

DLAT Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Ask
View Details
DLAT Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-62155R-BF594-02 100 µL

DLAT Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Ask
View Details