Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-7/IL-7

Source: E.coli. MW :17.5kD. Recombinant Human Interleukin-7 is produced by our E.coli expression system and the target gene encoding Asp26-His177 is expressed. Human Interleukin 7 (IL-7) is a potent lymphoid cell growth factor stimulating the proliferation of lymphoid progenitors. IL7 can associate with the hepatocyte growth factor (HGF) to form a hybrid cytokine that functions as a pre-pro-B cell growth-stimulating factor. Human IL7 cDNA encodes a 177 amino acid precursor protein containing a 25 amino acid signal peptide and a 152 amino acid mature protein. Human and mouse IL7 share 65% sequence identity in the mature region and both exhibit cross-species activity. IL-7 signals via IL-7 receptor (IL7R) activating multiple pathways including JaK/STAT and PI3K/AKT, which regulate lymphocyte survival, glucose uptake, proliferation, and differentiation. IL-7 is also associated with cytoplasmic IL2-R gamma for signal transduction.

Product Specifications

Gene Name

IL7

Gene ID

3574

UniProt

P13232

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 250mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

HSF2 (Heat Shock Transcription Factor 2) Chicken ELISA Kit
E1305 96 Tests

HSF2 (Heat Shock Transcription Factor 2) Chicken ELISA Kit

Ask
View Details
Mouse Protein CBFA2T1, Runx1t1 ELISA KIT
ELI-38592m 96 Tests

Mouse Protein CBFA2T1, Runx1t1 ELISA KIT

Ask
View Details
Mouse Monoclonal Claudin-3 Antibody (OTI1E7) [CoraFluor 1]
NBP2-70445CL1 0.1 mL

Mouse Monoclonal Claudin-3 Antibody (OTI1E7) [CoraFluor 1]

Ask
View Details
Rabbit anti-human pyrophosphatase (inorganic) 2 polyclonal Antibody
MBS714437-01 0.1 mL

Rabbit anti-human pyrophosphatase (inorganic) 2 polyclonal Antibody

Ask
View Details
Rabbit anti-human pyrophosphatase (inorganic) 2 polyclonal Antibody
MBS714437-02 5x 0.1 mL

Rabbit anti-human pyrophosphatase (inorganic) 2 polyclonal Antibody

Ask
View Details
APPL1 Antibody
A43512-100UL 100 µL

APPL1 Antibody

Ask
View Details