Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-7/IL-7

Source: E.coli. MW :17.5kD. Recombinant Human Interleukin-7 is produced by our E.coli expression system and the target gene encoding Asp26-His177 is expressed. Human Interleukin 7 (IL-7) is a potent lymphoid cell growth factor stimulating the proliferation of lymphoid progenitors. IL7 can associate with the hepatocyte growth factor (HGF) to form a hybrid cytokine that functions as a pre-pro-B cell growth-stimulating factor. Human IL7 cDNA encodes a 177 amino acid precursor protein containing a 25 amino acid signal peptide and a 152 amino acid mature protein. Human and mouse IL7 share 65% sequence identity in the mature region and both exhibit cross-species activity. IL-7 signals via IL-7 receptor (IL7R) activating multiple pathways including JaK/STAT and PI3K/AKT, which regulate lymphocyte survival, glucose uptake, proliferation, and differentiation. IL-7 is also associated with cytoplasmic IL2-R gamma for signal transduction.

Product Specifications

Gene Name

IL7

Gene ID

3574

UniProt

P13232

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 250mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human CC-chemokine receptor 5 (CCR5) Elisa Kit
EK710054 96 Well

Human CC-chemokine receptor 5 (CCR5) Elisa Kit

Ask
View Details
Filter Paper, Grade No. 540
2063752/4 1 Each

Filter Paper, Grade No. 540

Ask
View Details
CENP-B, Recombinant, Human (Centromere Protein B)
MBS638023-01 0.005 mg

CENP-B, Recombinant, Human (Centromere Protein B)

Ask
View Details
CENP-B, Recombinant, Human (Centromere Protein B)
MBS638023-02 0.02 mg

CENP-B, Recombinant, Human (Centromere Protein B)

Ask
View Details
CENP-B, Recombinant, Human (Centromere Protein B)
MBS638023-03 5x 0.02 mg

CENP-B, Recombinant, Human (Centromere Protein B)

Ask
View Details
Rabbit anti-Escherichia coli O139:H28 (strain E24377A/ETEC) CLPS Polyclonal Antibody
MBS7169883 Inquire

Rabbit anti-Escherichia coli O139:H28 (strain E24377A/ETEC) CLPS Polyclonal Antibody

Ask
View Details