Recombinant Rabbit Tumor Necrosis Factor a/TNF-a

Source: E.coli. MW :17.59kD. Recombinant Rabbit Tumor Necrosis Factor alpha is produced by our E.coli expression system and the target gene encoding Val77-Leu235 is expressed. Tumor necrosis factor alpha (TNFa) is the prototypic ligand of the TNF superfamily. TNFa forms a homotrimer and functions by activating two types of receptors TNF-R1 (TNF receptor type 1, p55R) and TNF-R2 (TNF receptor type 2, p75R) . TNFa is a pleiotropic cytokine that is capable to promote inflammation, to induce apoptotic cell death, and to inhibit tumorigenesis and viral replication. TNFa is a potent lymphoid factor that exerts cytotoxic effects on a wide range of tumor cells and certain other target cells.

Product Specifications

Gene Name

TNF

Gene ID

100009088

UniProt

P04924

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 300mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MVTLRSASRALSDKPLAHVVANPQVEGQLQWLSQRANALLANGMKLTDNQLVVPADGLYLIYSQVLFSGQGCRSYVLLTHTVSRFAVSYPNKVNLLSAIKSPCHRETPEEAEPMAWYEPIYLGGVFQLEKGDRLSTEVNQPEYLDLAESGQVYFGIIAL