Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pro-Brain-Derived Neurotrophic Factor/pro-BDNF

Source: E.coli. MW :52kD. Recombinant Human pro-Brain-Derived Neurotrophic Factor is produced by our E.coli expression system and the target gene encoding Ala19-Arg247 is expressed. The precursor form of Brain-Derived Neurotrophic Factor (pro-BDNF) interacts preferentially with the pan-neurotrophin receptor p75 (p75NTR) and vps10p domain-containing receptor sortilin and induces neuronal apoptosis, whereas mature BDNF selectively binds with high affinity to the TrkB kinase receptor and promotes the survival, growth and differentiation of neurons. As proneurotrophins and mature neurotrophins elicit opposite biological effects, Pro-BDNF cleavage in the neuronal system is regulated in a specific and cell-context dependent manner. Pro-BDNF plays important role in negative regulation of neurotrophic actions in the brain.

Product Specifications

Gene Name

BDNF

Gene ID

627

UniProt

P23560

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 250mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

p-Nitrophenyl Beta-D-Cellobioside
TRC-N503090-10MG 10 mg

p-Nitrophenyl Beta-D-Cellobioside

Sign In for Pricing
View Details
Recombinant Human HMGB1/HMG1 Protein (His Tag)
PKSH031684-01 100 µg

Recombinant Human HMGB1/HMG1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human HMGB1/HMG1 Protein (His Tag)
PKSH031684-02 500 µg

Recombinant Human HMGB1/HMG1 Protein (His Tag)

Sign In for Pricing
View Details
RUVBL1 Polyclonal Antibody
E-AB-66239-01 60 µL

RUVBL1 Polyclonal Antibody

Sign In for Pricing
View Details
RUVBL1 Polyclonal Antibody
E-AB-66239-02 120 µL

RUVBL1 Polyclonal Antibody

Sign In for Pricing
View Details
RUVBL1 Polyclonal Antibody
E-AB-66239-03 200 µL

RUVBL1 Polyclonal Antibody

Sign In for Pricing
View Details