Recombinant Human Brain-Derived Neurotrophic Factor/BDNF
Source: E.coli. MW :27kD. Recombinant Human Brain-Derived Neurotrophic Factor is produced by our E.coli expression system and the target gene encoding His129-Arg247 is expressed. Brain-Derived Neurotrophic Factor (BDNF) is a member of the neurotrophin family. Along with other structurally related neurotrophic factors NGF, NT-3 and NT-4, BDNF binds with high affinity to the TrkB kinase receptor. It also binds with the LNGFR (for low-affinity nerve growth factor receptor, also known as p75) . BDNF promotes the survival, growth and differentiation of neurons. It serves as a major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. BDNF expression is altered in neurodegenerative disorders such as Parkinson's and Alzheimer's disease.
Product Specifications
Gene Name
BDNF
Gene ID
627
UniProt
P23560
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 250mM NaCl, pH 7.2.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Amino Acids
MHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items