Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Brain-Derived Neurotrophic Factor/BDNF

Source: E.coli. MW :27kD. Recombinant Human Brain-Derived Neurotrophic Factor is produced by our E.coli expression system and the target gene encoding His129-Arg247 is expressed. Brain-Derived Neurotrophic Factor (BDNF) is a member of the neurotrophin family. Along with other structurally related neurotrophic factors NGF, NT-3 and NT-4, BDNF binds with high affinity to the TrkB kinase receptor. It also binds with the LNGFR (for low-affinity nerve growth factor receptor, also known as p75) . BDNF promotes the survival, growth and differentiation of neurons. It serves as a major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. BDNF expression is altered in neurodegenerative disorders such as Parkinson's and Alzheimer's disease.

Product Specifications

Gene Name

BDNF

Gene ID

627

UniProt

P23560

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 250mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse cross-linked C-telopeptides of Type Ⅰ collagen,CⅠCP ELISA Kit
CN-02716M2 48T

Mouse cross-linked C-telopeptides of Type Ⅰ collagen,CⅠCP ELISA Kit

Ask
View Details
Rabbit Polyclonal TBCA Antibody [FITC]
NBP2-97322F 0.1 mL

Rabbit Polyclonal TBCA Antibody [FITC]

Ask
View Details
Human Non-receptor tyrosine-protein kinase TNK1,TNK1 ELISA KIT
ELI-36460h 96 Tests

Human Non-receptor tyrosine-protein kinase TNK1,TNK1 ELISA KIT

Ask
View Details
Mouse mmu-miR-743a-5p miRNA Agomir
abx883564-01 5 nmol

Mouse mmu-miR-743a-5p miRNA Agomir

Ask
View Details
Mouse mmu-miR-743a-5p miRNA Agomir
abx883564-02 10 nmol

Mouse mmu-miR-743a-5p miRNA Agomir

Ask
View Details
Mouse Monoclonal Integrin alpha 2/CD49b Antibody (31H4) [Alexa Fluor 405]
NBP2-50145AF405 0.1 mL

Mouse Monoclonal Integrin alpha 2/CD49b Antibody (31H4) [Alexa Fluor 405]

Ask
View Details