Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Galectin-7/LGALS7 (E. coli)

Source: E. coli. MW :14.9kD. Recombinant Human Galectin-7 is produced by our E.coli expression system and the target gene encoding Met1-Phe136 is expressed. The Galectin family of proteins, with specificity for Nacetyllactosamine containing glycoproteins, consists of beta-galactoside binding lectins containing homologous carbohydrate recognition domains (CRDs) .They also possess hemagglutination activity, which is attributable to their bivalent carbohydrate binding properties. Galectins are active both intracellularly and extracellularly. Although they are localized primarily in the cytoplasm and lack a classical signal peptide; they can be secreted by one or more as yet unidentified non-classical secretory pathways. They have diverse effects on many cellular functions including adhesion, migration, polarity, chemotaxis, proliferation, apoptosis, and differentiation. Galectins may play a key role in many pathological states, including autoimmune diseases, allergic reactions, inflammation, tumor cell metastasis, atherosclerosis, and diabetic complications.

Product Specifications

Gene Name

LGALS7

Gene ID

3963

UniProt

P47929

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test. Biological Activity : Activation measured by its ability to agglutinate human red blood cells.

Amino Acids

MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

GENLISA™ Horse Interleukin 1 Receptor Antagonist (IL1RA)ELISA
KLV0183 1x 96 Well

GENLISA™ Horse Interleukin 1 Receptor Antagonist (IL1RA)ELISA

Ask
View Details
Rabbit anti-cIAP1 Antibody
YLD1873-01 50 µL

Rabbit anti-cIAP1 Antibody

Ask
View Details
Rabbit anti-cIAP1 Antibody
YLD1873-02 100 µL

Rabbit anti-cIAP1 Antibody

Ask
View Details
C17orf104 (MEIOC) (NM_001145080) Human Tagged Lenti ORF Clone
RC226526L3 10 µg

C17orf104 (MEIOC) (NM_001145080) Human Tagged Lenti ORF Clone

Ask
View Details
HEG1 Knockout 786-O Polyclonal Cells
ARG25244 1 Million

HEG1 Knockout 786-O Polyclonal Cells

Ask
View Details
FLIP (FLICE Inhibitory Protein) (MaxLight 405) discontinued
F4550-03-ML405 100 µL

FLIP (FLICE Inhibitory Protein) (MaxLight 405) discontinued

Ask
View Details