Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Galectin-3/LGALS3 (E. coli)

Source: E. coli. MW :26kD. Recombinant Human Galectin-3 is produced by our E.coli expression system and the target gene encoding Ala2-Ile250 is expressed. The Galectin family of proteins (with specificity for Nacetyllactosamine containing glycoproteins) consists of beta-galactoside binding lectins containing homologous carbohydrate recognition domains (CRDs) . At least 14 mammalian galectins family members that share structural similarities in their carbohydrate recognition domains (CRD) have been identified to date. Unlike the selectin family of proteins, the carbohydrate binding specificity of galectins is calcium-independent. A common function of galectins is to cross-link structures containing N-acetyl-lactosamine located at the cell surface and within the extracellular matrix. They also possess hemagglutination activity, which is attributable to their bivalent carbohydrate binding properties. Galectins are active both intracellularly and extracellularly. They have diverse effects on many cellular functions including adhesion, migration, polarity, chemotaxis, proliferation, apoptosis, and differentiation. Galectins may therefore play a key role in many pathological states, including autoimmune diseases, allergic reactions, inflammation, tumor cell metastasis, atherosclerosis, and diabetic complications. The galectins have been classified into the prototype galectins (1, 2, 5, 7, 10, 11, 13, 14), which contain one CRD and exist either as a monomer or a noncovalent homodimer. The chimera galectins (Galectin3) containing one CRD linked to a nonlectin domain, and the tandem repeat Galectins (4, 6, 8, 9, 12) consisting of two CRDs joined by a linker peptide. Galectins lack a classical signal peptide and can be localized to the cytosolic compartments where they have intracellular functions. However, via one or more as yet unidentified nonclassical secretory pathways, galectins can also be secreted to function extracellularly. Individual members of the galectin family have different tissue distribution profiles and exhibit subtle differences in their carbohydrate-binding specificities. Each family member may preferentially bind to a unique subset of cell surface glycoproteins.

Product Specifications

Gene Name

LGALS3

Gene ID

3958

UniProt

P17931

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 2mM DTT, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test. Biological Activity : Activation measured by its ability to agglutinate human red blood cells.

Amino Acids

ADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral human CARTPT shRNA (UAS) - Lentiviral human CARTPT shRNA (UAS, iRFP) (25)
GTR15310157 1 Vial

Lentiviral human CARTPT shRNA (UAS) - Lentiviral human CARTPT shRNA (UAS, iRFP) (25)

Ask
View Details
REMBRANDT® LSI 10p14-ISH probe mix biotin
C740P.0100.05 5 Assays

REMBRANDT® LSI 10p14-ISH probe mix biotin

Ask
View Details
CACYBP (Calcyclin-binding Protein, CacyBP, hCacyBP, S100A6-binding Protein, Siah-interacting Protein, MGC87971, PNAS-107, S100A6BP, SIP) (PE)
124228-PE 100 µL

CACYBP (Calcyclin-binding Protein, CacyBP, hCacyBP, S100A6-binding Protein, Siah-interacting Protein, MGC87971, PNAS-107, S100A6BP, SIP) (PE)

Ask
View Details