Recombinant Human C-C Motif Chemokine 27/CCL27
Source: E.coli. MW :10.1kD. Recombinant Human C-C Motif Chemokine 27 is produced by our E.coli expression system and the target gene encoding Phe25-Gly112 is expressed. Human Chemokine (C-C Motif) Ligand 27 (CCL27) is a small cytokine that is a member of the CC chemokine family; it is expressed in numerous tissues, including gonads, thymus, placenta and skin. CCL27 elicits its chemotactic effects by binding to the chemokine receptor CCR10. Predominantly expressed in the skin, CCL27 is associated with T cell-mediated inflammation of the skin. Human and Mouse CCL27 share 84% sequence identity in the mature form.
Product Specifications
Gene Name
CCL27
Gene ID
10850
UniProt
Q9Y4X3
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 500mM NaCl, pH 7.5.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Amino Acids
FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items