Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-C Motif Chemokine 27/CCL27

Source: E.coli. MW :10.1kD. Recombinant Human C-C Motif Chemokine 27 is produced by our E.coli expression system and the target gene encoding Phe25-Gly112 is expressed. Human Chemokine (C-C Motif) Ligand 27 (CCL27) is a small cytokine that is a member of the CC chemokine family; it is expressed in numerous tissues, including gonads, thymus, placenta and skin. CCL27 elicits its chemotactic effects by binding to the chemokine receptor CCR10. Predominantly expressed in the skin, CCL27 is associated with T cell-mediated inflammation of the skin. Human and Mouse CCL27 share 84% sequence identity in the mature form.

Product Specifications

Gene Name

CCL27

Gene ID

10850

UniProt

Q9Y4X3

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 500mM NaCl, pH 7.5.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Parp16 (NM_177460) Mouse Tagged Lenti ORF Clone
MR204648L4 10 µg

Parp16 (NM_177460) Mouse Tagged Lenti ORF Clone

Ask
View Details
3,5-Dibromo-D-tyrosine 5g
A23417-5000 5000 mg

3,5-Dibromo-D-tyrosine 5g

Ask
View Details
NR4A1 Antibody
ABD7850 100 µg

NR4A1 Antibody

Ask
View Details
MIR30e Human qPCR Template Standard (MI0000749)
HK300298 200 Reactions

MIR30e Human qPCR Template Standard (MI0000749)

Ask
View Details
POSTN Rabbit Monoclonal Antibody (Capture)
E56PA1078 100 µL

POSTN Rabbit Monoclonal Antibody (Capture)

Ask
View Details
DL- a-Tocopherol Acetate (Vitamin E acetate) 50% Powder
245080-01 50 g

DL- a-Tocopherol Acetate (Vitamin E acetate) 50% Powder

Ask
View Details