Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-C Motif Chemokine 3/CCL3

Source: E.coli. MW :7.5kD. Recombinant Human C-C Motif Chemokine 3 is produced by our E.coli expression system and the target gene encoding Ser24-Ala92 is expressed. Human Chemokine (C-C Motif) Ligand 3 (CCL3) is a small cytokine belonging to the CC chemokine family. CCL3 is primarily expressed in T cells, B cells, and monocytes after antigen or mitogen stimulation. CCL3 exhibits chemoattractive and adhesive effects on lymphocytes. CCL3 exerts multiple effects on hematopoietic precursor cells and inhibits the proliferation of hematopoietic stem cells in vitro as well as in vivo. CCR1 and CCR5 have been identified as functional receptors for CCL3.

Product Specifications

Gene Name

CCL3

Gene ID

6348

UniProt

P10147

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test. Biological Activity : ED50 is 3-10 ng/mL.

Amino Acids

SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Ntan1 Mouse siRNA Oligo Duplex (Locus ID 18203)
SR409436 1 Kit

Ntan1 Mouse siRNA Oligo Duplex (Locus ID 18203)

Ask
View Details
Human TMX1 siRNA
abx937557-01 15 nmol

Human TMX1 siRNA

Ask
View Details
Human TMX1 siRNA
abx937557-02 30 nmol

Human TMX1 siRNA

Ask
View Details
Anti-HLA-DQA1 (1A3)
YF-MA13469 100 ug

Anti-HLA-DQA1 (1A3)

Ask
View Details
R2A Agar
LA0700 250 g

R2A Agar

Ask
View Details
Rabbit Monoclonal LAMP-1/CD107a Antibody (107) [PerCP]
NBP2-89844PCP 0.1 mL

Rabbit Monoclonal LAMP-1/CD107a Antibody (107) [PerCP]

Ask
View Details