Recombinant Human beta-Nerve Growth Factor/ beta-NGF (Ser122-Ala241, E. coli)
Source: E.coli. MW :13.4kD. Recombinant Human beta-Nerve Growth Factor is produced by our E.coli expression system and the target gene encoding Ser122-Ala241 is expressed. Human beta-Nerve Growth Factor (beta-NGF) was initially isolated in the mouse submandibular gland. It is composed of three non-covalently linked subunits a, beta, and gamma; it exhibits all the biological activities ascribed to NGF. It is structurally related to BDNF, NT-3 and NT-4 and belongs to the cysteine-knot family of growth factors that assume stable dimeric structures. B-NGF is a neurotrophic factor that signals through its receptor beta-NGF, and plays a crucial role in the development and preservation of the sensory and sympathetic nervous systems. B-NGF also acts as a growth and differentiation factor for B lymphocytes and enhances B-cell survival. These results suggest that beta-NGF is a pleiotropic cytokine, which in addition to its neurotropic activities may have an important role in the regulation of the immune system. Human beta-NGF shares 90% sequence similarity with mouse protein and shows cross-species reactivity.
Product Specifications
Gene Name
NGF
Gene ID
4803
UniProt
P01138
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 250mM NaCl, pH 7.0.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Amino Acids
SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog