Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human beta-Nerve Growth Factor/ beta-NGF (Ser122-Ala241, E. coli)

Source: E.coli. MW :13.4kD. Recombinant Human beta-Nerve Growth Factor is produced by our E.coli expression system and the target gene encoding Ser122-Ala241 is expressed. Human beta-Nerve Growth Factor (beta-NGF) was initially isolated in the mouse submandibular gland. It is composed of three non-covalently linked subunits a, beta, and gamma; it exhibits all the biological activities ascribed to NGF. It is structurally related to BDNF, NT-3 and NT-4 and belongs to the cysteine-knot family of growth factors that assume stable dimeric structures. B-NGF is a neurotrophic factor that signals through its receptor beta-NGF, and plays a crucial role in the development and preservation of the sensory and sympathetic nervous systems. B-NGF also acts as a growth and differentiation factor for B lymphocytes and enhances B-cell survival. These results suggest that beta-NGF is a pleiotropic cytokine, which in addition to its neurotropic activities may have an important role in the regulation of the immune system. Human beta-NGF shares 90% sequence similarity with mouse protein and shows cross-species reactivity.

Product Specifications

Gene Name

NGF

Gene ID

4803

UniProt

P01138

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 250mM NaCl, pH 7.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test. Biological Activity : ED50 is less than 1.0 ng/ml. Specific Activity is greater than 1 x 10^6 IU/mg.

Amino Acids

SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

5-Acetyl-2-aminobenzonitrile
TRC-A168115-250MG 250 mg

5-Acetyl-2-aminobenzonitrile

Ask
View Details
Recombinant Human IL-16 CF
316-IL-025/CF 25 µg

Recombinant Human IL-16 CF

Ask
View Details
EDG-3 discontinued
388552 200 µL

EDG-3 discontinued

Ask
View Details
PRSS8 (Serine Protease 8, CAP1, Prostasin) discontinued
212835-01 50 µL

PRSS8 (Serine Protease 8, CAP1, Prostasin) discontinued

Ask
View Details
PRSS8 (Serine Protease 8, CAP1, Prostasin) discontinued
212835-02 100 µL

PRSS8 (Serine Protease 8, CAP1, Prostasin) discontinued

Ask
View Details
PRSS8 (Serine Protease 8, CAP1, Prostasin) discontinued
212835-03 200 µL

PRSS8 (Serine Protease 8, CAP1, Prostasin) discontinued

Ask
View Details