Recombinant Human C-X-C Motif Chemokine 14/CXCL14
Source: E.coli. MW :9.4kD. Recombinant Human C-X-C Motif Chemokine 14 is produced by our E.coli expression system and the target gene encoding Ser35-Glu111 is expressed. Human Chemokine (C-X-C Motif) Ligand 14 (CXCL14) is constitutively expressed in certain normal tissues but is reduced or absent from many established tumor cell lines and human cancers. CXCL14 is known to be a chemoattractant for monocyte and dendritic cells. CXCL14 inhibits angiogenesis and exhibits antimicrobial activities. Mature human and mouse CXCL14 differ by only 2 amino acid residues.
Product Specifications
Gene Name
CXCL14
Gene ID
9547
UniProt
O95715
Components
Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 1M NaCl, pH 8.5.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Amino Acids
SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
Explore Other Products
Browse additional items from our catalog