Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-X-C Motif Chemokine 14/CXCL14

Source: E.coli. MW :9.4kD. Recombinant Human C-X-C Motif Chemokine 14 is produced by our E.coli expression system and the target gene encoding Ser35-Glu111 is expressed. Human Chemokine (C-X-C Motif) Ligand 14 (CXCL14) is constitutively expressed in certain normal tissues but is reduced or absent from many established tumor cell lines and human cancers. CXCL14 is known to be a chemoattractant for monocyte and dendritic cells. CXCL14 inhibits angiogenesis and exhibits antimicrobial activities. Mature human and mouse CXCL14 differ by only 2 amino acid residues.

Product Specifications

Gene Name

CXCL14

Gene ID

9547

UniProt

O95715

Components

Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 1M NaCl, pH 8.5.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test. Biological Activity : ED50 is 1.0-10.0 ng/ml.

Amino Acids

SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE

More Discoveries

Explore Other Products

Browse additional items from our catalog

LINC00404 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV731580 1.0 µg DNA

LINC00404 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Mouse Ankyrin-2 ELISA Kit
MBS2880447-01 48 Well

Mouse Ankyrin-2 ELISA Kit

Sign In for Pricing
View Details
Mouse Ankyrin-2 ELISA Kit
MBS2880447-02 96 Well

Mouse Ankyrin-2 ELISA Kit

Sign In for Pricing
View Details
Mouse Ankyrin-2 ELISA Kit
MBS2880447-03 5x 96 Well

Mouse Ankyrin-2 ELISA Kit

Sign In for Pricing
View Details
Mouse Ankyrin-2 ELISA Kit
MBS2880447-04 10x 96 Well

Mouse Ankyrin-2 ELISA Kit

Sign In for Pricing
View Details
Recombinant Neisseria Gonorrhoeae trmA Protein (aa 1-362) (strain ATCC 700825 / FA 1090)
VAng-Wyb2839-500gEcoli 500 µg (E. coli)

Recombinant Neisseria Gonorrhoeae trmA Protein (aa 1-362) (strain ATCC 700825 / FA 1090)

Sign In for Pricing
View Details