Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-X-C Motif Chemokine 7/CXCL7/NAP-2

Source: E.coli. MW :7.6kD. Recombinant Human C-X-C Motif Chemokine 7 is produced by our E.coli expression system and the target gene encoding Ala59-Asp128 is expressed. Human Chemokine (C-X-C motif) Ligand 7 (CXCL7), also known as neutrophil activating peptide 2 (NAP-2), is a member of the CXC chemokines containing an ELR domain (Glu-Leu-Arg tripeptide motif) . Similar to other ELR domain containing CXC chemokines, such as IL-8 and the GRO proteins, CXCL7 binds CXCR2, chemoattracts and activates neutrophils. CXCL7, Connective Tissue Activating Protein III (CTAPIII) and betathrombogulin (betaTG), are proteolytically processed carboxylterminal fragments of platelet basic protein (PBP) which is found in the alphagranules of human platelets. Although CTAPIII, betaTG, and PBP represent amino-terminal extended variants of NAP2 and possess the same CXC chemokine domains, these proteins do not exhibit CXCL7/NAP2 activity. CXCL7 induces cell migration through the G-protein-linked receptor CXCR-2.

Product Specifications

Gene Name

PPBP

Gene ID

5473

UniProt

P02775

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test. Biological Activity : ED50 is 0.1-0.5 ng/mL.

Amino Acids

AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Interleukin-5 ELISA Kit
MBS9425086-01 96 Tests

Human Interleukin-5 ELISA Kit

Sign In for Pricing
View Details
Human Interleukin-5 ELISA Kit
MBS9425086-02 5x 96 Tests

Human Interleukin-5 ELISA Kit

Sign In for Pricing
View Details
Apolipoprotein A-I (Apo-AI, ApoA-I, Apolipoprotein A1) discontinued
215238 100 µg

Apolipoprotein A-I (Apo-AI, ApoA-I, Apolipoprotein A1) discontinued

Sign In for Pricing
View Details
BRCA1 Polyclonal Antibody
MBS9457616-01 0.05 mL

BRCA1 Polyclonal Antibody

Sign In for Pricing
View Details
BRCA1 Polyclonal Antibody
MBS9457616-02 0.1 mL

BRCA1 Polyclonal Antibody

Sign In for Pricing
View Details
BRCA1 Polyclonal Antibody
MBS9457616-03 5x 0.1 mL

BRCA1 Polyclonal Antibody

Sign In for Pricing
View Details