Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-X-C Motif Chemokine 10/CXCL10

Source: E.coli. MW :8.6kD. Recombinant Human C-X-C Motif Chemokine 10 is produced by our E.coli expression system and the target gene encoding Val22-Pro98 is expressed. Human C-X-C Motif Chemokine Ligand 10 (CXCL10) is a non-ELR chemokine secreted by various cell types, such as monocytes, endothelial cells and fibroblasts, in response to IFN-gamma. CXCL10 functions via chemokine receptor CXCR3. CXCL10 has been attributed to several roles, such as chemoattraction for activated T-lymphocytes, inhibition of angiogenesis, and antitumor activity.

Product Specifications

Gene Name

CXCL10

Gene ID

3627

UniProt

P02778

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test. Biological Activity : ED50 is 0.02-0.06 ?g/mL.

Amino Acids

VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Escherichia phage lambda (Bacteriophage lambda) stf Polyclonal Antibody
MBS7166637 Inquire

Rabbit anti-Escherichia phage lambda (Bacteriophage lambda) stf Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-phospho-ZNF598 (Tyr306) antibody
SL12222R-01 50 µL

Rabbit Anti-phospho-ZNF598 (Tyr306) antibody

Sign In for Pricing
View Details
Rabbit Anti-phospho-ZNF598 (Tyr306) antibody
SL12222R-02 100 µL

Rabbit Anti-phospho-ZNF598 (Tyr306) antibody

Sign In for Pricing
View Details
Potato Dextrose Agar, Granulated
GM096A-500G 500 g

Potato Dextrose Agar, Granulated

Sign In for Pricing
View Details
Agtr1 Recombinant Antibody
RAC07130-01 50 µL

Agtr1 Recombinant Antibody

Sign In for Pricing
View Details
Agtr1 Recombinant Antibody
RAC07130-02 100 µL

Agtr1 Recombinant Antibody

Sign In for Pricing
View Details