Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Myelin Oligodendrocyte Glycoprotein/MOG

Source: E.coli. MW :15.2kD. Recombinant Human Myelin Oligodendrocyte Glycoprotein is produced by our E.coli expression system and the target gene encoding Gly30-Gly154 is expressed with a 6His tag at the C-terminus. Myelin Oligodendrocyte Glycoprotein (MOG) is a transmembrane protein, which is expressed exclusively in the CNS. MOG contains a single Ig-domain exposed to the extracellular space that allows autoantibodies easy access. MOG protein has been identified as a crucial autoantigen for multiple sclerosis in humans. MOG is capable to produce a demyelinating multiple sclerosis-like diseases in experimental animals, namely experimental autoimmune encephalomyelitis (EAE), in rodents and monkeys.

Product Specifications

Gene Name

MOG

Gene ID

4340

UniProt

Q16653

Components

Lyophilized from a 0.2 μm filtered solution of 20mM HAc-NaAc, 150mM NaCl, pH 4.5.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test. Biological Activity : Tested for capability to induce EAE in rodents and monkeys

Amino Acids

MGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Pepsinogen II (PG II) antibody
E35D1133 100 µL

Pepsinogen II (PG II) antibody

Ask
View Details
Mouse Vwa3a activation kit by CRISPRa
GA214480 1 Kit

Mouse Vwa3a activation kit by CRISPRa

Ask
View Details
Goat Solute Carrier Family 25 Member 46 (SLC25A46) ELISA Kit
MBS7259979-01 48 Well

Goat Solute Carrier Family 25 Member 46 (SLC25A46) ELISA Kit

Ask
View Details
Goat Solute Carrier Family 25 Member 46 (SLC25A46) ELISA Kit
MBS7259979-02 96 Well

Goat Solute Carrier Family 25 Member 46 (SLC25A46) ELISA Kit

Ask
View Details
Goat Solute Carrier Family 25 Member 46 (SLC25A46) ELISA Kit
MBS7259979-03 5x 96 Well

Goat Solute Carrier Family 25 Member 46 (SLC25A46) ELISA Kit

Ask
View Details
Goat Solute Carrier Family 25 Member 46 (SLC25A46) ELISA Kit
MBS7259979-04 10x 96 Well

Goat Solute Carrier Family 25 Member 46 (SLC25A46) ELISA Kit

Ask
View Details