Recombinant Human Myelin Oligodendrocyte Glycoprotein/MOG
Source: E.coli. MW :15.2kD. Recombinant Human Myelin Oligodendrocyte Glycoprotein is produced by our E.coli expression system and the target gene encoding Gly30-Gly154 is expressed with a 6His tag at the C-terminus. Myelin Oligodendrocyte Glycoprotein (MOG) is a transmembrane protein, which is expressed exclusively in the CNS. MOG contains a single Ig-domain exposed to the extracellular space that allows autoantibodies easy access. MOG protein has been identified as a crucial autoantigen for multiple sclerosis in humans. MOG is capable to produce a demyelinating multiple sclerosis-like diseases in experimental animals, namely experimental autoimmune encephalomyelitis (EAE), in rodents and monkeys.
Product Specifications
Gene Name
MOG
Gene ID
4340
UniProt
Q16653
Components
Lyophilized from a 0.2 μm filtered solution of 20mM HAc-NaAc, 150mM NaCl, pH 4.5.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Amino Acids
MGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGHHHHHH
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items