Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-4/IL-4 (E. coli)

Source: E.coli. MW :15.1kD. Recombinant Human Interleukin-4 is produced by our E.coli expression system and the target gene encoding His25-Ser153 is expressed. Interleukin-4 (IL-4) is a pleiotropic cytokine that regulates diverse T and B cell responses including cell proliferation, survival and gene expression. IL-4 is produced by mast cells, T cells, and bone marrow stromal cells. IL-4 regulates the differentiation of naive CD4+ T cells into helper Th2 cells, characterized by their cytokine-secretion profile that includes secretion of IL-4, IL-5, IL-6, IL-10, and IL-13, which favor a humoral immune response. Another dominant function of IL-4 is the regulation of immunoglobulin class switching to the IgG1 and IgE isotypes. Excessive IL-4 production by Th2 cells has been associated with elevated IgE production and allergic response.

Product Specifications

Gene Name

IL4

Gene ID

3565

UniProt

P05112

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test. Biological Activity : ED50 is less than 2 ng/ml. Specific Activity of 5.0 x 10^6 IU/mg.

Amino Acids

MHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

MTHFD1 (C-1-tetrahydrofolate Synthase, Cytoplasmic, C1-THF Synthase, Methylenetetrahydrofolate Dehydrogenase, Methenyltetrahydrofolate Cyclohydrolase, Formyltetrahydrofolate Synthetase, MTHFC, MTHFD) (FITC)
MBS6386086-01 0.1 mL

MTHFD1 (C-1-tetrahydrofolate Synthase, Cytoplasmic, C1-THF Synthase, Methylenetetrahydrofolate Dehydrogenase, Methenyltetrahydrofolate Cyclohydrolase, Formyltetrahydrofolate Synthetase, MTHFC, MTHFD) (FITC)

Ask
View Details
MTHFD1 (C-1-tetrahydrofolate Synthase, Cytoplasmic, C1-THF Synthase, Methylenetetrahydrofolate Dehydrogenase, Methenyltetrahydrofolate Cyclohydrolase, Formyltetrahydrofolate Synthetase, MTHFC, MTHFD) (FITC)
MBS6386086-02 5x 0.1 mL

MTHFD1 (C-1-tetrahydrofolate Synthase, Cytoplasmic, C1-THF Synthase, Methylenetetrahydrofolate Dehydrogenase, Methenyltetrahydrofolate Cyclohydrolase, Formyltetrahydrofolate Synthetase, MTHFC, MTHFD) (FITC)

Ask
View Details
Normal Human IgG Isotype Control Antibody, APC
E55A08044 50 Tests

Normal Human IgG Isotype Control Antibody, APC

Ask
View Details
Serotonin-OVA
80-1417 1 mg

Serotonin-OVA

Ask
View Details
OGG1 (NM_016826) Human Tagged ORF Clone
RG221784 10 µg

OGG1 (NM_016826) Human Tagged ORF Clone

Ask
View Details