Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast Growth Factor 1/FGF-1/FGFa (Phe16-Asp155)

Source: E. coli. MW :15.9kD. Recombinant Human Fibroblast growth factor 1 is produced by our E.coli expression system and the target gene encoding Phe16-Asp155 is expressed. FGF acidic, also known as ECGF, FGF-1and HBGF-1, is a non-glycosylated heparin binding growth factor that is expressed in the brain, kidney, retina, smooth muscle cells, bone matrix, osteoblasts, astrocytes and endothelial cells. It is a mitogenic peptide that is produced by multiple cell types and stimulates the proliferation of cells of mesodermal, ectodermal, and endodermal origin. Its association with heparan sulfate is a prerequisite for activation of FGF receptors. Internalized FGF acidic migrates to the nucleus where it is phosphorylated by nuclear PKC delta, exported to the cytosol, dephosphorylated, and degraded. Intracellular FGF acidic inhibits p53 activity and proapoptotic signaling.

Product Specifications

Gene Name

FGF1

Gene ID

2246

UniProt

P05230

Components

Lyophilized from a 0.2 μm filtered solution of 20mM Tris, 400mM NaCl, 1mM DTT, pH 8.0, The ED50 for this effect is less than 2 ng/ml, measured in a cell proliferation assay using BALB/c 3T3 cells.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-ALKBH7 antibody
STJ22590 100 µl

Anti-ALKBH7 antibody

Ask
View Details
PSMC3IP ORF Vector (Human) (pORF)
37982011 1.0 µg DNA

PSMC3IP ORF Vector (Human) (pORF)

Ask
View Details
pCMV-EMCN-3×FLAG-Neo Plasmid
PVT54158 2 µg

pCMV-EMCN-3×FLAG-Neo Plasmid

Ask
View Details
CDC42EP1 Recombinant Antibody, APC-Cy5.5 Conjugated
bsm-61339R-APC-Cy5.5 100 µL

CDC42EP1 Recombinant Antibody, APC-Cy5.5 Conjugated

Ask
View Details
RO-3
256495 10 mg

RO-3

Ask
View Details
CRMP5 (DPYSL5) CytoSection
TS402631P5 25 Slides

CRMP5 (DPYSL5) CytoSection

Ask
View Details