Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Growth Hormone/GH

Source: E.coli. MW: 21.9kD. Recombinant Mouse Growth Hormone is produced by our E.coli expression system and the target gene encoding Phe27-Phe216 is expressed. Growth Hormone (GH), also known as somatotropin, is a member of a family of growth factors that includes prolactin, placental lactogens, proliferins, and somatolactin. It is a peptide hormone that stimulates growth, cell reproduction, and cell regeneration in humans and other animals. Mouse Somatotropin (GH) is a member of the somatotropin/prolactin family of hormones, which play an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. GH stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues.

Product Specifications

Gene Name

Gh1

Gene ID

14599

UniProt

P06880

Components

Lyophilized from a 0.2 μm filtered solution of 50mM TrisHCl, 500mM NaCl, pH 8.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in distilled water. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDLEEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea Pig Cartilage glycoprotein 39/YKL40/Chitinase 3 like Protein 1 ELISA kit
GTR10472398 96 Well

Guinea Pig Cartilage glycoprotein 39/YKL40/Chitinase 3 like Protein 1 ELISA kit

Sign In for Pricing
View Details
PHAX Protein Lysate (Mouse) with C-HA Tag
36529034 100 µg

PHAX Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Glycophorin A (GYPA, Glycophorin A (includes MN Blood Group, CD235a, CD235a Antigen, Glycophorin A Precursor, GPA, GPErik, GpMiIII, GPSAT, HGpMiIII, HGpMiV, HGpMiX, HGpMiXI, HGpSta (C), MN, MNS, MN Sialoglycoprotein, PAS-2, Sialoglycoprotein alpha) (FITC) discontinued
G8177-12E-FITC 100 µL

Glycophorin A (GYPA, Glycophorin A (includes MN Blood Group, CD235a, CD235a Antigen, Glycophorin A Precursor, GPA, GPErik, GpMiIII, GPSAT, HGpMiIII, HGpMiV, HGpMiX, HGpMiXI, HGpSta (C), MN, MNS, MN Sialoglycoprotein, PAS-2, Sialoglycoprotein alpha) (FITC) discontinued

Sign In for Pricing
View Details
KLHL3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
25793061 1.0 µg DNA

KLHL3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
ATOH8 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
12654061 1.0 µg DNA

ATOH8 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Skint7 3'UTR Lenti-reporter-Luc Vector
43837084 1.0 µg

Skint7 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details