Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-22/IL-22 (E. coli)

Source: E.coli. MW :16.7kD. Recombinant Mouse Interleukin-22 is produced by our E.coli expression system and the target gene encoding Leu34-Val179 is expressed. Interleukin-22 (IL-22) was initially identified as a gene induced by IL-9 in mouse T cells and mast cells. Mouse IL-22 cDNA encodes a 179 amino acid residue protein with a putative 33 amino acid signal peptide that is cleaved to generate a 147 amino acid mature protein that shares approximately 79% and 22% sequence identity with human IL22 and IL10, respectively. IL22 has been shown to activate STAT-1 and STAT-3 in several hepatoma cell lines and up-regulate the production of acute phase proteins. IL-22 is produced by normal mouse T cells upon Con A activation. Mouse IL-22 expression is also induced in various organs upon lipopolysaccharide injection, suggesting that IL-22 may be involved in inflammatory responses. The functional IL-22 receptor complex consists of two receptor subunits, IL-22R (previously an orphan receptor named CRF2-9) and IL-10R beta (previously known as CRF2-4), belonging to the class II cytokine receptor family.

Product Specifications

Gene Name

Il22

Gene ID

50929

UniProt

Q9JJY9

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MLPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Dimethyl sulfoxide (DMSO) for molecular biology
1084ML050 50 mL

Dimethyl sulfoxide (DMSO) for molecular biology

Ask
View Details
Magic™ Human MET CHO-K1 Cell Line
S01YF-0123-KX38 1 Vial

Magic™ Human MET CHO-K1 Cell Line

Ask
View Details
Rabbit anti-Drosophila melanogaster (Fruit fly) CG9393 Polyclonal Antibody
MBS9014946 Inquire

Rabbit anti-Drosophila melanogaster (Fruit fly) CG9393 Polyclonal Antibody

Ask
View Details
Anti-Human IL11RA Antibody (SAA2023)
RHG84901 100 μg

Anti-Human IL11RA Antibody (SAA2023)

Ask
View Details
ZCCHC7 Antibody - C-terminal region
ARP60538_P050-25UL 25 µL

ZCCHC7 Antibody - C-terminal region

Ask
View Details
Ets2 (NM_001107107) Rat Tagged ORF Clone Lentiviral Particle
RR205122L3V 200 µL

Ets2 (NM_001107107) Rat Tagged ORF Clone Lentiviral Particle

Ask
View Details