Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-22/IL-22 (E. coli)

Source: E.coli. MW :16.7kD. Recombinant Mouse Interleukin-22 is produced by our E.coli expression system and the target gene encoding Leu34-Val179 is expressed. Interleukin-22 (IL-22) was initially identified as a gene induced by IL-9 in mouse T cells and mast cells. Mouse IL-22 cDNA encodes a 179 amino acid residue protein with a putative 33 amino acid signal peptide that is cleaved to generate a 147 amino acid mature protein that shares approximately 79% and 22% sequence identity with human IL22 and IL10, respectively. IL22 has been shown to activate STAT-1 and STAT-3 in several hepatoma cell lines and up-regulate the production of acute phase proteins. IL-22 is produced by normal mouse T cells upon Con A activation. Mouse IL-22 expression is also induced in various organs upon lipopolysaccharide injection, suggesting that IL-22 may be involved in inflammatory responses. The functional IL-22 receptor complex consists of two receptor subunits, IL-22R (previously an orphan receptor named CRF2-9) and IL-10R beta (previously known as CRF2-4), belonging to the class II cytokine receptor family.

Product Specifications

Gene Name

Il22

Gene ID

50929

UniProt

Q9JJY9

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MLPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral human PEX7 shRNA (UAS) - Lentiviral human PEX7 shRNA (UAS, RFP) plasmid
GTR15096733 1 Vial

Lentiviral human PEX7 shRNA (UAS) - Lentiviral human PEX7 shRNA (UAS, RFP) plasmid

Ask
View Details
S6K1 recombinant monoclonal antibody
A5512 100ul X 3

S6K1 recombinant monoclonal antibody

Ask
View Details
TNFSF11 Protein (N-human IgG1-Fc, Mouse)
P529160 100 µg

TNFSF11 Protein (N-human IgG1-Fc, Mouse)

Ask
View Details
Mannose Phosphate Isomerase (MPI) (NM_002435) Human Over-expression Lysate
LS004351-100ug 100 µg

Mannose Phosphate Isomerase (MPI) (NM_002435) Human Over-expression Lysate

Ask
View Details
Wingless Type MMTV Integration Site Family, Member 3A (WNT3A) BioAssayTM ECL ELISA Kit (Rat) discontinued
158209-01 48 Tests

Wingless Type MMTV Integration Site Family, Member 3A (WNT3A) BioAssayTM ECL ELISA Kit (Rat) discontinued

Ask
View Details
Wingless Type MMTV Integration Site Family, Member 3A (WNT3A) BioAssayTM ECL ELISA Kit (Rat) discontinued
158209-02 96 Tests

Wingless Type MMTV Integration Site Family, Member 3A (WNT3A) BioAssayTM ECL ELISA Kit (Rat) discontinued

Ask
View Details