Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast Growth Factor 2/FGF-2/FGFb (Gly132-Ser288)

Source: E. coli. MW :16.4kD. Recombinant Human Fibroblast growth factor 2 is produced by our E.coli expression system and the target gene encoding Gly132-Ser288 is expressed. FGF-basic is a members of the Fibroblast Growth Factors (FGFs) family.The family constitutes a large family of proteins involved in many aspects of development including cell proliferation, growth, and differentiation. They act on several cell types to regulate diverse physiologic functions including angiogenesis, cell growth, pattern formation, embryonic development, metabolic regulation, cell migration, neurotrophic effects, and tissue repair. FGF-basic is a non-glycosylated heparin binding growth factor that is expressed in the brain, pituitary, kidney, retina, bone, testis, adrenal gland liver, monocytes, epithelial cells and endothelial cells. FGF-basic signals through FGFR 1b, 1c, 2c, 3c and 4.

Product Specifications

Gene Name

FGF2

Gene ID

2247

UniProt

P09038

Components

Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 7.5.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test. Biological Activity : The ED50 for this effect is less than 0.6 ng/mL, measured in a cell proliferation assay using BALB/c 3T3 cells.

Amino Acids

GTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PTMA, NT (PTMA, TMSA, Prothymosin alpha, Thymosin alpha-1) (MaxLight 490) discontinued
040640-ML490 100 µL

PTMA, NT (PTMA, TMSA, Prothymosin alpha, Thymosin alpha-1) (MaxLight 490) discontinued

Ask
View Details
Jun B (JunB, Jun B proto-oncogene, Transcription factor jun-B) discontinued
J7998-10A 100 µg

Jun B (JunB, Jun B proto-oncogene, Transcription factor jun-B) discontinued

Ask
View Details
KCNAB1 polyclonal antibody
BS76257-01 50 µL

KCNAB1 polyclonal antibody

Ask
View Details
KCNAB1 polyclonal antibody
BS76257-02 100 µL

KCNAB1 polyclonal antibody

Ask
View Details
SCY1 like 3 (SCYL3) CytoSection
TS404859P5 25 Slides

SCY1 like 3 (SCYL3) CytoSection

Ask
View Details
HDAC8 (Histone Deacetylase 8, HD 8, HD8, CDA07, Histone Deacetylase-like 1, HDACL1) (Azide Free) (FITC)
H1827-56F-FITC 100 µL

HDAC8 (Histone Deacetylase 8, HD 8, HD8, CDA07, Histone Deacetylase-like 1, HDACL1) (Azide Free) (FITC)

Ask
View Details