Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Fibroblast Growth Factor 2/FGF-2/FGFb (Met1-Ser154)

Source: E.coli. MW :17.15kD. Recombinant Mouse Fibroblast growth factor 2 is produced by our E.coli expression system and the target gene encoding Met1-Ser154 is expressed. FGF basic is one of 22 mitogenic proteins of the FGF family, which show 35-60% amino acid conservation. Unlike other FGFs, FGF acidic and basic lack signal peptides and are secreted by an alternate pathway. The 17 kDa mouse sequence has 98% aa identity with rat, and 95% identity with human, bovine, and sheep FGF basic. Binding of FGF to heparin or cell surface HSPG is necessary for binding, dimerization and activation of tyrosine kinase FGF receptors. FGF basic binds other proteins, polysaccharides and lipids with lower affinity. Expression of FGF basic is nearly ubiquitous but disruption of the mouse FGF basic gene gives a relatively mild phenotype, suggesting compensation by other FGF family members. FGF basic modulates such normal processes as angiogenesis, wound healing and tissue repair, embryonic development and differentiation, neuronal function and neural degeneration. Transgenic overexpression of FGF basic results in excessive proliferation and angiogenesis is reminiscent of a variety of pathological conditions.

Product Specifications

Gene Name

Fgf2

Gene ID

14173

UniProt

P15655

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 400mM NaCl, pH 7.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MAASGITSLPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Boc-(S)-2-amino-4,4-difluorobutyric acid
MBS9022406-01 1 g

Boc-(S)-2-amino-4,4-difluorobutyric acid

Ask
View Details
Boc-(S)-2-amino-4,4-difluorobutyric acid
MBS9022406-02 5x 1 g

Boc-(S)-2-amino-4,4-difluorobutyric acid

Ask
View Details
Mitogen-Activated Protein Kinase 1 (Mapk1/Erk2/Mapk/Prkm1) Mouse ELISA Kit
F0437 96 Tests

Mitogen-Activated Protein Kinase 1 (Mapk1/Erk2/Mapk/Prkm1) Mouse ELISA Kit

Ask
View Details
Angiomotin-L1 Polyclonal Antibody
JOT-AP00442-01 50ul

Angiomotin-L1 Polyclonal Antibody

Ask
View Details
Angiomotin-L1 Polyclonal Antibody
JOT-AP00442-02 100ul

Angiomotin-L1 Polyclonal Antibody

Ask
View Details
hCG_1646157 antibody - N-terminal region
MBS3210164-01 0.1 mL

hCG_1646157 antibody - N-terminal region

Ask
View Details