Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-1 beta/IL-1 beta

Source: E.coli. MW :17.4kD. Recombinant Mouse Interleukin-1 beta is produced by our E.coli expression system and the target gene encoding Val118-Ser269 is expressed. Interleukin-1 (IL-1) designates two proteins, IL-1a and IL-1 beta, which are the products of distinct genes, but recognize the same cell surface receptors. IL-1a and IL-1 beta are structurally related polypeptides that show approximately 25% homology at the amino acid level. Both proteins are produced by a wide variety of cells in response to stimuli such as those produced by inflammatory agents, infections, or microbial endotoxins. The proteins are synthesized as 31 kDa precursors that are subsequently cleaved into proteins with molecular weights of approximately 17.5 kDa. The specific protease responsible for the processing of IL-1 beta, designated interleukin 1 beta-converting enzyme (ICE), has been described. Mature human and mouse IL-1 beta share approximately 75% amino acid sequence identity and human IL-1 beta has been found to be active on murine cell lines.

Product Specifications

Gene Name

Il1b

Gene ID

16176

UniProt

P10749

Components

Lyophilized from a 0.2 μm filtered solution of 50mM TrisHCl, 50mM NaCl, pH 8.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test. Biological Activity : ED50 is less than 0.01 ng/ml. Specific Activity of 1.0 x 10^8 IU/mg.

Amino Acids

VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBFOX2 (NM_001082576) Human Over-expression Lysate
E45H04999-2 20 µg

RBFOX2 (NM_001082576) Human Over-expression Lysate

Sign In for Pricing
View Details
Human PGE ELISA Kit
E110725 1 Each

Human PGE ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Mafa shRNA (UAS) - Lentiviral mouseMafa shRNA (UAS, GFP) (25)
GTR15231740 1 Vial

Lentiviral mouse Mafa shRNA (UAS) - Lentiviral mouseMafa shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
ICOSLG Antibody
A25758-100UL 100 µL

ICOSLG Antibody

Sign In for Pricing
View Details
Tmem259 (NM_001003949) Mouse Tagged ORF Clone
MG215186 10 µg

Tmem259 (NM_001003949) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Ksr2 Mouse Gene Knockout Kit (CRISPR)
KN509083 1 Kit

Ksr2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details