Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-8/IL-8 (Ser28-Ser99)

Source: E.coli. MW :8.45kD. Recombinant Human Interleukin-8 is produced by our E.coli expression system and the target gene encoding Ser28-Ser99 is expressed. Interleukin-8 (IL-8) belongs to the neutrophil-specific CXC family of chemokines. It is one of the initial cytokines released from a variety of cell types, including T cells, endothelial cells and fibroblasts, in response to an inflammatory stimulus and acts by recruiting neutrophils, T-cells and basophils to the site of inflammation. Elevated Interleukin-8 levels are associated with the onset of a variety of disease states.

Product Specifications

Gene Name

CXCL8

Gene ID

3576

UniProt

P10145

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test. Biological Activity : ED50 is less than 2 ng/ml. Specific Activity of 5.0 x 10^5 IU/mg.

Amino Acids

SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human Zinc finger protein 652, ZNF652 ELISA Kit
MBS9340448-01 48 Well

Human Zinc finger protein 652, ZNF652 ELISA Kit

Ask
View Details
Human Zinc finger protein 652, ZNF652 ELISA Kit
MBS9340448-02 96 Well

Human Zinc finger protein 652, ZNF652 ELISA Kit

Ask
View Details
Human Zinc finger protein 652, ZNF652 ELISA Kit
MBS9340448-03 5x 96 Well

Human Zinc finger protein 652, ZNF652 ELISA Kit

Ask
View Details
Human Zinc finger protein 652, ZNF652 ELISA Kit
MBS9340448-04 10x 96 Well

Human Zinc finger protein 652, ZNF652 ELISA Kit

Ask
View Details
TET2
553267 100 µg

TET2

Ask
View Details
PE-Linked Polyclonal Antibody to Vitamin D Receptor (VDR)
MBS2042803-01 0.1 mL

PE-Linked Polyclonal Antibody to Vitamin D Receptor (VDR)

Ask
View Details