Recombinant Human Stem Cell Factor/SCF/c-Kit Ligand
Source: E.coli. MW :18.4kD. Recombinant Human Stem Cell Factor is produced by our E.coli expression system and the target gene encoding Glu26-Ala189 is expressed. Stem Cell Factor (SCF) is a hematopoietic growth factor that exerts its activity at the early stages of hematopoiesis. SCF stimulates the proliferation of myeloid, erythroid, and lymphoid progenitors in bone marrow cultures and has been shown to act synergistically with colony stimulating factors.
Product Specifications
Gene Name
KITLG
Gene ID
4254
UniProt
P21583
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.0.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
Applications Notes
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test. Biological Activity : ED50 is less than 2 ng/ml. Specific Activity of 5.0 x 10^5 IU/mg.
Amino Acids
MEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
ARP68966_P050-HRP 100 µL
TMEM121 Antibody - N-terminal region : HRP (ARP68966_P050-HRP)
Sign In for Pricing
View Details 
ARP65347_P050 100 µL
MOB1B antibody - C-terminal region (ARP65347_P050)
Sign In for Pricing
View Details