Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Stem Cell Factor/SCF/c-Kit Ligand

Source: E.coli. MW :18.4kD. Recombinant Human Stem Cell Factor is produced by our E.coli expression system and the target gene encoding Glu26-Ala189 is expressed. Stem Cell Factor (SCF) is a hematopoietic growth factor that exerts its activity at the early stages of hematopoiesis. SCF stimulates the proliferation of myeloid, erythroid, and lymphoid progenitors in bone marrow cultures and has been shown to act synergistically with colony stimulating factors.

Product Specifications

Gene Name

KITLG

Gene ID

4254

UniProt

P21583

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test. Biological Activity : ED50 is less than 2 ng/ml. Specific Activity of 5.0 x 10^5 IU/mg.

Amino Acids

MEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PCMV-Gmppb-Neo Plasmid
PVT81555 2 µg

PCMV-Gmppb-Neo Plasmid

Ask
View Details
TCEA1 (Transcription Elongation Factor A (SII), 1, GTF2S, SII, TCEA, TF2S, TFIIS) (APC)
134271-APC 100 µL

TCEA1 (Transcription Elongation Factor A (SII), 1, GTF2S, SII, TCEA, TF2S, TFIIS) (APC)

Ask
View Details
IgG, IgA, IgM, H&L, X-adsorbed (FITC)
MBS614352-01 1 mg

IgG, IgA, IgM, H&L, X-adsorbed (FITC)

Ask
View Details
IgG, IgA, IgM, H&L, X-adsorbed (FITC)
MBS614352-02 5x 1 mg

IgG, IgA, IgM, H&L, X-adsorbed (FITC)

Ask
View Details
Gpx8 Mouse shRNA Lentiviral Particle (Locus ID 69590)
TL515000V 500 µL Each

Gpx8 Mouse shRNA Lentiviral Particle (Locus ID 69590)

Ask
View Details
Lentiviral mouse Zfp3 shRNA (UAS) - Lentiviral mouse Zfp3 shRNA (UAS, RFP) plasmid
GTR15227761 1 Vial

Lentiviral mouse Zfp3 shRNA (UAS) - Lentiviral mouse Zfp3 shRNA (UAS, RFP) plasmid

Ask
View Details