Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human IL-1 Receptor Antagonist Protein/IL-1RA/IL-1F3

Source: E.coli. MW :17.26kD. Recombinant Human Interleukin-1 Receptor Antagonist Protein is produced by our E.coli expression system and the target gene encoding Arg26-Glu177 is expressed. Interleukin-1 Receptor Antagonist (IL-1RN) is a member of the IL-1 family. Endogenous IL-1RN is produced in numerous animal disease models as well as in human autoimmune and chronic inflammatory diseases. It binds to IL-1 receptors in competition with IL-1, but does not elicit intracellular response from this binding. Its role in counteracting the proinflammatory effects of IL-1 is being studied by numerous research groups. IL-4 and IL-13 have been shown to amplify the stimulatory effect of IL1-beta on the production of soluble and intracellular forms of IL-1RN. The regulated expression of IL-1RN in various cell types has been shown to be influenced by cytokines. In synovial fibroblasts, IL-1, TNF-alpha, or PDGF markedly enhances the synthesis of IL-1RN.

Product Specifications

Gene Name

IL1RN

Gene ID

3557

UniProt

P18510

Components

Lyophilized from a 0.2 μm filtered solution of 50mM TrisHCl, 200mM NaCl, pH 7.5.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test. Biological Activity : ED50 is 0.5 ng/ml. Specific Activity of 2.0 x 10^6 IU/mg.

Amino Acids

MRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

OCP1 CRISPRa sgRNA lentivector (set of three targets)(Human)
63056121 3x 1.0µg DNA

OCP1 CRISPRa sgRNA lentivector (set of three targets)(Human)

Ask
View Details
Methyl-CpG-binding domain protein 5 (MBD5) Human ELISA Kit
E9691 96 Tests

Methyl-CpG-binding domain protein 5 (MBD5) Human ELISA Kit

Ask
View Details
ZNF3 Antibody, HRP conjugated
MBS7109089-01 0.05 mg

ZNF3 Antibody, HRP conjugated

Ask
View Details
ZNF3 Antibody, HRP conjugated
MBS7109089-02 0.1 mg

ZNF3 Antibody, HRP conjugated

Ask
View Details
ZNF3 Antibody, HRP conjugated
MBS7109089-03 5x 0.1 mg

ZNF3 Antibody, HRP conjugated

Ask
View Details
OR52A5 (NM_001005160) Human Tagged ORF Clone
RC221506 10 µg

OR52A5 (NM_001005160) Human Tagged ORF Clone

Ask
View Details