Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Insulin-Like Growth Factor I/IGF-I/IGF1 (4-70)

Source: E.coli. MW :7.3kD. Recombinant Human Insulin-like Growth Factor I is produced by our E.coli expression system and the target gene encoding Thr52-Ala118 is expressed. Insulin-like growth factor I (IGF1) belongs to the family of insulin-like growth factors that are structurally homologous to proinsulin. Mature IGFs are generated by proteolytic processing of inactive precursor protein containing N-terminal and C-terminal propeptide regions. Mature human IGF-I consisting of 70 amino acids with 94% identity with mouse IGF1 and exhibits cross-species activity. IGF1 binds IGF-1R, IGF-2R, and the insulin receptor and plays a key role in cell cycle progression, cell proliferation and tumor progression. IGF1 expression is regulated by growth hormone.

Product Specifications

Gene Name

IGF1

Gene ID

3479

UniProt

P05019

Components

Lyophilized from a 0.2 μm filtered solution of 300mM NaAc, pH 6.5.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in 500mM Acetic Acid. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.05 ng/μg (0.5 IEU/μg) as determined by LAL test.

Amino Acids

TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

IL-4I1 Polyclonal Antibody, Cy5.5 Conjugated
bs-6841R-Cy5.5 100 µL

IL-4I1 Polyclonal Antibody, Cy5.5 Conjugated

Ask
View Details
Glycoprotein A33 (GPA33) Antibody
abx210838-01 50 µL

Glycoprotein A33 (GPA33) Antibody

Ask
View Details
Glycoprotein A33 (GPA33) Antibody
abx210838-02 100 µL

Glycoprotein A33 (GPA33) Antibody

Ask
View Details
Recombinant Human Glutamate--cysteine ligase regulatory subunit (GCLM)
MBS953997-01 0.02 mg (E-Coli)

Recombinant Human Glutamate--cysteine ligase regulatory subunit (GCLM)

Ask
View Details
Recombinant Human Glutamate--cysteine ligase regulatory subunit (GCLM)
MBS953997-02 0.02 mg (Yeast)

Recombinant Human Glutamate--cysteine ligase regulatory subunit (GCLM)

Ask
View Details
Recombinant Human Glutamate--cysteine ligase regulatory subunit (GCLM)
MBS953997-03 0.1 mg (E-Coli)

Recombinant Human Glutamate--cysteine ligase regulatory subunit (GCLM)

Ask
View Details