Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-17F/IL-17F

Source: E.coli. MW :30.1kD. Recombinant Human Interleukin-17F is produced by our E.coli expression system and the target gene encoding Arg31-Gln163 is expressed. Interleukin-17 is a potent pro-inflammatory cytokine produced by activated memory T cells. There are at least six members of the IL-17 family in humans and in mice. Today, IL-17 represents a family of structurally related cytokines that share a highly conserved C-terminal region but differ from one another in their N-terminal regions and in their distinct biological roles. The six known members of this family, IL-17A through IL-17F, are secreted as homodimers. IL-17F also regulates cartilage matrix turnover and inhibits angiogenesis.

Product Specifications

Gene Name

IL17F

Gene ID

112744

UniProt

Q96PD4

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in 500mM Acetic Acid. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test. Biological Activity : ED50 is approximately 10 ng/ml. Specific Activity of 1.0 x 10^5 IU/mg

Amino Acids

MRKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

MOAP1 (Modulator of Apoptosis 1, MAP-1, MAP1, Paraneoplastic Antigen Ma4, PNMA4) (MaxLight 550)
129775-ML550 100 µL

MOAP1 (Modulator of Apoptosis 1, MAP-1, MAP1, Paraneoplastic Antigen Ma4, PNMA4) (MaxLight 550)

Ask
View Details
Recombinant Human ZNF724 Protein
E30P3572 20 µg

Recombinant Human ZNF724 Protein

Ask
View Details