Recombinant Human Epidermal Growth Factor/EGF
Source: E.coli. MW :6.2kD. Recombinant Human Epidermal Growth Factor is produced by our E.coli expression system and the target gene encoding Asn971-Arg1023 is expressed. Epidermal growth factor (EGF) is a small mitogenic protein that is thought to be involved in mechanisms such as normal cell growth, oncogenesis, and wound healing. This protein shows both strong sequential and functional homology with human type-alpha transforming growth factor (hTGF alpha), which is a competitor for EGF receptor sites. EGF is a small 53 amino acid residue long protein that contains three disulfide bridges
Product Specifications
Gene Name
EGF
Gene ID
1950
UniProt
P01133
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 200mM NaCl, pH 7.0.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Amino Acids
NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items