Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Epidermal Growth Factor/EGF

Source: E.coli. MW :6.2kD. Recombinant Human Epidermal Growth Factor is produced by our E.coli expression system and the target gene encoding Asn971-Arg1023 is expressed. Epidermal growth factor (EGF) is a small mitogenic protein that is thought to be involved in mechanisms such as normal cell growth, oncogenesis, and wound healing. This protein shows both strong sequential and functional homology with human type-alpha transforming growth factor (hTGF alpha), which is a competitor for EGF receptor sites. EGF is a small 53 amino acid residue long protein that contains three disulfide bridges

Product Specifications

Gene Name

EGF

Gene ID

1950

UniProt

P01133

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 200mM NaCl, pH 7.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test. Biological Activity : ED50 is less than 2 ng/ml.

Amino Acids

NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SGCE (NM_003919) Human Tagged Lenti ORF Clone
RC205363L4 10 µg

SGCE (NM_003919) Human Tagged Lenti ORF Clone

Ask
View Details
SENP1 Rabbit Polyclonal Antibody
TA312368 100 µL

SENP1 Rabbit Polyclonal Antibody

Ask
View Details
Recombinant Human MET
MBS7613571-01 0.05 mg

Recombinant Human MET

Ask
View Details
Recombinant Human MET
MBS7613571-02 0.2 mg

Recombinant Human MET

Ask
View Details
Recombinant Human MET
MBS7613571-03 1 mg

Recombinant Human MET

Ask
View Details
Recombinant Human MET
MBS7613571-04 5x 1 mg

Recombinant Human MET

Ask
View Details