Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interferon a2A Variant (Lys46) /IFN-a2A

Source: E.coli. MW :19.24kD. Recombinant Human Interferon alpha-2a is produced by our E.coli expression system and the target gene encoding Cys24-Glu188 is expressed. At least 23 different variants of IFN-a are known. The individual proteins have molecular masses between 19-26 kDa and consist of proteins with lengths of 156-166 and 172 amino acids. All IFN-a subtypes possess a common conserved sequence region between amino acid positions 115-151 while the amino-terminal ends are variable. Many IFN-a subtypes only differ in their sequences by one or two positions. Naturally occurring variants also include proteins truncated by 10 amino acids at the carboxy-terminal end.

Product Specifications

Gene Name

IFNA2

Gene ID

3440

UniProt

P01563

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test. Biological Activity : Specific Activity is greater than 1.0 x 10^8 IU/ mg.

Amino Acids

MCDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Protein Lysate, Skin
CP565579 150 µg

Tissue Protein Lysate, Skin

Sign In for Pricing
View Details
Bax Mouse Gene Knockout Kit (CRISPR)
KN501986 1 Kit

Bax Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GOPC Rabbit Monoclonal Antibody [Clone ID: 23GB5870]
TA424827 100 µL

GOPC Rabbit Monoclonal Antibody [Clone ID: 23GB5870]

Sign In for Pricing
View Details
3,3',3''-(2,4,6-boroxintriyl)tris-Pyridine Hydrochloride (>70%)
TRC-P997025-500MG 500 mg

3,3',3''-(2,4,6-boroxintriyl)tris-Pyridine Hydrochloride (>70%)

Sign In for Pricing
View Details
Cyclin B3 (CCNB3) Human Gene Knockout Kit (CRISPR)
KN417591 1 Kit

Cyclin B3 (CCNB3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Total RNA, Colon
CR559758 5 µg

Tissue Total RNA, Colon

Sign In for Pricing
View Details