Recombinant Human LR3 Insulin-Like Growth Factor I/LR3-IGF-1 (MG)
Source: E.coli. MW :9.1kD. Recombinant Human LR3-IGF-1 is produced by our E.coli expression system and the target gene encoding Gly49-Ala118 is expressed. Insulin-like growth factor I (IGF1) belongs to the family of insulin-like growth factors that are structurally homologous to proinsulin. Mature IGFs are generated by proteolytic processing of inactive precursor proteins, which contains the N- and C-terminal propeptide regions. Mature human IGF-I consisting of 70 amino acids has 94% identity with mouse IGF-I and exhibits cross-species activity. IGF-1 binds IGF-IR, IGF-IIR, and the insulin receptor and plays a key role in cell cycle progression, cell proliferation and tumor progression. IGF-1 expression is regulated by growth hormone. R3 IGF-1 is an 83 amino acid analog of IGF-1 comprising the complete human IGF-1 sequence with the substitution of an Arg (R) for the Glu (E) at position three, hence R3, and a 13 amino acid extension peptide at the N terminus. R3 IGF-1 has been produced with the purpose of increasing biological activity. R3 IGF-1 is significantly more potent than human IGF-I in vitro.
Product Specifications
Gene Name
IGF1
Gene ID
3479
UniProt
P05019
Components
Lyophilized from a 0.2 μm filtered solution of 300mM HAc-NaAc, pH 6.5.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Amino Acids
MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items