Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human LR3 Insulin-Like Growth Factor I/LR3-IGF-1 (MG)

Source: E.coli. MW :9.1kD. Recombinant Human LR3-IGF-1 is produced by our E.coli expression system and the target gene encoding Gly49-Ala118 is expressed. Insulin-like growth factor I (IGF1) belongs to the family of insulin-like growth factors that are structurally homologous to proinsulin. Mature IGFs are generated by proteolytic processing of inactive precursor proteins, which contains the N- and C-terminal propeptide regions. Mature human IGF-I consisting of 70 amino acids has 94% identity with mouse IGF-I and exhibits cross-species activity. IGF-1 binds IGF-IR, IGF-IIR, and the insulin receptor and plays a key role in cell cycle progression, cell proliferation and tumor progression. IGF-1 expression is regulated by growth hormone. R3 IGF-1 is an 83 amino acid analog of IGF-1 comprising the complete human IGF-1 sequence with the substitution of an Arg (R) for the Glu (E) at position three, hence R3, and a 13 amino acid extension peptide at the N terminus. R3 IGF-1 has been produced with the purpose of increasing biological activity. R3 IGF-1 is significantly more potent than human IGF-I in vitro.

Product Specifications

Gene Name

IGF1

Gene ID

3479

UniProt

P05019

Components

Lyophilized from a 0.2 μm filtered solution of 300mM HAc-NaAc, pH 6.5.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in 500mM Acetic Acid. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.05 ng/μg (0.5 IEU/μg) as determined by LAL test. Biological Activity : ED50 is greater than 200 ng/ml.

Amino Acids

MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human PLEKHD1 activation kit by CRISPRa
GA118266 1 Kit

Human PLEKHD1 activation kit by CRISPRa

Ask
View Details
Human Prolactin enzyme-linked immunoassay kit
EH0089 96 Tests

Human Prolactin enzyme-linked immunoassay kit

Ask
View Details
Non-printed, assembled Screw Cap Tube, Self-Standing, PP, 1.5 mL, Sterile, with EPDM ring Cap, Red - 1000 un, DNase/RNase free - ABDOS
P40230R 1000 Units/Pack

Non-printed, assembled Screw Cap Tube, Self-Standing, PP, 1.5 mL, Sterile, with EPDM ring Cap, Red - 1000 un, DNase/RNase free - ABDOS

Ask
View Details
Phospho-SYK (Tyr352) Antibody
AF4432-01 100 µL

Phospho-SYK (Tyr352) Antibody

Ask
View Details
Phospho-SYK (Tyr352) Antibody
AF4432-02 200 µL

Phospho-SYK (Tyr352) Antibody

Ask
View Details
Rat Protein phosphatase 1 regulatory subunit 14B (PPP1R14B) ELISA Kit
MBS7243932-01 48 Well

Rat Protein phosphatase 1 regulatory subunit 14B (PPP1R14B) ELISA Kit

Ask
View Details